Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: 2ABASample Type: Hela Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human PPP2R2A Polyclonal Antibody | anti-PPP2R2A antibody

PPP2R2A Antibody - N-terminal region

Gene Names
PPP2R2A; B55A; PR52A; PR55A; B55ALPHA; PR55alpha
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
PPP2R2A; Polyclonal Antibody; PPP2R2A Antibody - N-terminal region; anti-PPP2R2A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SERDKRPEGYNLKEEDGRYRDPTTVTTLRVPVFRPMDLMVEASPRRIFAN
Sequence Length
447
Applicable Applications for anti-PPP2R2A antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human 2ABA
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: 2ABASample Type: Hela Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: 2ABASample Type: Hela Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-PPP2R2A antibody
This is a rabbit polyclonal antibody against 2ABA. It was validated on Western Blot

Target Description: The product of this gene belongs to the phosphatase 2 regulatory subunit B family. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes an alpha isoform of the regulatory subunit B55 subfamily. Alternatively spliced transcript variants have been described.
Product Categories/Family for anti-PPP2R2A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49kDa
NCBI Official Full Name
serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform isoform 1
NCBI Official Synonym Full Names
protein phosphatase 2 regulatory subunit Balpha
NCBI Official Symbol
PPP2R2A
NCBI Official Synonym Symbols
B55A; PR52A; PR55A; B55ALPHA; PR55alpha
NCBI Protein Information
serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform
UniProt Protein Name
Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform
UniProt Gene Name
PPP2R2A
UniProt Entry Name
2ABA_HUMAN

NCBI Description

The product of this gene belongs to the phosphatase 2 regulatory subunit B family. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes an alpha isoform of the regulatory subunit B55 subfamily. Alternatively spliced transcript variants have been described. [provided by RefSeq, Apr 2010]

Uniprot Description

PPP2R2A: The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment. Found in a complex with at least ARL2, PPP2CB, PPP2R1A, PPP2R2A, PPP2R5E and TBCD. PP2A consists of a common heterodimeric core enzyme, composed of a 36 kDa catalytic subunit (subunit C) and a 65 kDa constant regulatory subunit (PR65 or subunit A), that associates with a variety of regulatory subunits. Proteins that associate with the core dimer include three families of regulatory subunits B (the R2/B/PR55/B55, R3/B''/PR72/PR130/PR59 and R5/B'/B56 families), the 48 kDa variable regulatory subunit, viral proteins, and cell signaling molecules. Interacts with TP53. Expressed in all tissues examined. Belongs to the phosphatase 2A regulatory subunit B family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Protein phosphatase, regulatory subunit

Chromosomal Location of Human Ortholog: 8p21.2

Cellular Component: nucleoplasm; protein phosphatase type 2A complex; cytosol

Molecular Function: protein binding; protein phosphatase type 2A regulator activity; protein serine/threonine phosphatase activity

Biological Process: mitotic nuclear envelope reassembly; regulation of catalytic activity; mRNA catabolic process, nonsense-mediated decay; response to morphine; gene expression; mitotic cell cycle; G2/M transition of mitotic cell cycle; signal transduction; protein amino acid dephosphorylation

Research Articles on PPP2R2A

Similar Products

Product Notes

The PPP2R2A ppp2r2a (Catalog #AAA3219548) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PPP2R2A Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PPP2R2A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PPP2R2A ppp2r2a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SERDKRPEGY NLKEEDGRYR DPTTVTTLRV PVFRPMDLMV EASPRRIFAN. It is sometimes possible for the material contained within the vial of "PPP2R2A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.