Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PPP2CASample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

Rabbit PPP2CA Polyclonal Antibody | anti-PPP2CA antibody

PPP2CA antibody - N-terminal region

Gene Names
PPP2CA; RP-C; PP2Ac; PP2CA; PP2Calpha
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PPP2CA; Polyclonal Antibody; PPP2CA antibody - N-terminal region; anti-PPP2CA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIG
Sequence Length
309
Applicable Applications for anti-PPP2CA antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PPP2CASample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PPP2CASample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RatTarget Name: PPP2CASample Tissue: Rat BrainAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RatTarget Name: PPP2CASample Tissue: Rat BrainAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-PPP2CA AntibodyPositive Control: Lane 1: 40ug HEK293 lysate Lane 2: 40ug H1299 lysatePrimary Antibody Dilution : 1:1000Secondary Antibody : Goat anti-rabbit-HRPSecondry Antibody Dilution : 1:5000Submitted by: Jose Luis Rosa, Universitat de Barcelona )

Western Blot (WB) (WB Suggested Anti-PPP2CA AntibodyPositive Control: Lane 1: 40ug HEK293 lysate Lane 2: 40ug H1299 lysatePrimary Antibody Dilution : 1:1000Secondary Antibody : Goat anti-rabbit-HRPSecondry Antibody Dilution : 1:5000Submitted by: Jose Luis Rosa, Universitat de Barcelona )

Western Blot (WB)

(WB Suggested Anti-PPP2CA AntibodyTitration: 1.0 ug/mlPositive Control: MDA-MB-435S Whole Cell)

Western Blot (WB) (WB Suggested Anti-PPP2CA AntibodyTitration: 1.0 ug/mlPositive Control: MDA-MB-435S Whole Cell)
Related Product Information for anti-PPP2CA antibody
This is a rabbit polyclonal antibody against PPP2CA. It was validated on Western Blot

Target Description: This gene encodes the phosphatase 2A catalytic subunit. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. This gene encodes an alpha isoform of the catalytic subunit.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform isoform 1
NCBI Official Synonym Full Names
protein phosphatase 2 catalytic subunit alpha
NCBI Official Symbol
PPP2CA
NCBI Official Synonym Symbols
RP-C; PP2Ac; PP2CA; PP2Calpha
NCBI Protein Information
serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
UniProt Protein Name
Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
UniProt Gene Name
PPP2CA
UniProt Synonym Gene Names
PP2A-alpha; RP-C
UniProt Entry Name
PP2AA_HUMAN

NCBI Description

This gene encodes the phosphatase 2A catalytic subunit. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. This gene encodes an alpha isoform of the catalytic subunit. [provided by RefSeq, Jul 2008]

Uniprot Description

PPP2CA: ubiquitous cytosolic Ser/Thr protein phosphatase, catalytic subunit. The holoenzyme consists of a 36 kDa catalytic subunit (subunit C) and a 65 kDa constant regulatory subunit (PR65 or subunit A), that associates with a variety of regulatory subunits. Proteins that associate with the core dimer include three families of regulatory subunits B (the R2/B/PR55/B55, R3/B'/PR72/PR130/PR59 and R5/B'/B56 families), the 48 kDa variable regulatory subunit, viral proteins, and cell signaling molecules.

Protein type: EC 3.1.3.16; Motility/polarity/chemotaxis; Protein phosphatase, Ser/Thr (non-receptor)

Chromosomal Location of Human Ortholog: 5q31.1

Cellular Component: microtubule cytoskeleton; spindle pole; protein phosphatase type 2A complex; membrane; mitochondrion; plasma membrane; nucleus; cytosol; chromosome, pericentric region

Molecular Function: protein dimerization activity; protein C-terminus binding; protein binding; metal ion binding; GABA receptor binding; protein serine/threonine phosphatase activity

Biological Process: mitotic nuclear envelope reassembly; apoptosis; regulation of protein amino acid autophosphorylation; protein amino acid dephosphorylation; response to organic substance; regulation of transcription, DNA-dependent; meiotic cell cycle; regulation of cell differentiation; regulation of growth; mesoderm development; regulation of receptor activity; regulation of DNA replication; inactivation of MAPK activity; second-messenger-mediated signaling; regulation of cell adhesion; fibroblast growth factor receptor signaling pathway; RNA splicing; regulation of Wnt receptor signaling pathway; negative regulation of tyrosine phosphorylation of Stat3 protein; mRNA catabolic process, nonsense-mediated decay; gene expression; regulation of protein catabolic process; mitotic cell cycle; negative regulation of cell growth; ceramide metabolic process

Research Articles on PPP2CA

Similar Products

Product Notes

The PPP2CA ppp2ca (Catalog #AAA3215860) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PPP2CA antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PPP2CA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PPP2CA ppp2ca for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LSESQVKSLC EKAKEILTKE SNVQEVRCPV TVCGDVHGQF HDLMELFRIG. It is sometimes possible for the material contained within the vial of "PPP2CA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.