Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PPP1R3CSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Rabbit PPP1R3C Polyclonal Antibody | anti-PPP1R3C antibody

PPP1R3C antibody - N-terminal region

Gene Names
PPP1R3C; PTG; PPP1R5
Reactivity
Dog, Horse, Human, Pig, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PPP1R3C; Polyclonal Antibody; PPP1R3C antibody - N-terminal region; anti-PPP1R3C antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Horse, Human, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PPVKSFLGPYDEFQRRHFVNKLKPLKSCLNIKHKAKSQNDWKCSHNQAKK
Sequence Length
317
Applicable Applications for anti-PPP1R3C antibody
Western Blot (WB)
Homology
Dog: 79%; Horse: 79%; Human: 100%; Pig: 79%; Rabbit: 79%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PPP1R3CSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PPP1R3CSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: PPP1R3CSample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PPP1R3CSample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Lanes:1:1ug insoluble STUB1 protein, 2:1ug soluble STUB1 protein, 3:1ug EPM2A protein, 4:1ug insoluble PPP1R3C protein, 5:1ug soluble PPP1R3C proteinPrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit-APSecondary Antibody Dilution:1:20,000Gene Name:PPP1R3CSubmitted by:Pedro Castanheira, Biocant)

Western Blot (WB) (Lanes:1:1ug insoluble STUB1 protein, 2:1ug soluble STUB1 protein, 3:1ug EPM2A protein, 4:1ug insoluble PPP1R3C protein, 5:1ug soluble PPP1R3C proteinPrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit-APSecondary Antibody Dilution:1:20,000Gene Name:PPP1R3CSubmitted by:Pedro Castanheira, Biocant)

Western Blot (WB)

(WB Suggested Anti-PPP1R3C AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole Cell)

Western Blot (WB) (WB Suggested Anti-PPP1R3C AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole Cell)
Related Product Information for anti-PPP1R3C antibody
This is a rabbit polyclonal antibody against PPP1R3C. It was validated on Western Blot

Target Description: Protein phosphatase-1 participates in the regulation of a wide variety of cellular functions by reversible protein phosphorylation. The ability of PP1 to regulate diverse functions resides in its capacity to interact with a variety of regulatory subunits that may target PP1 to specific subcellular locations, modulate its substrate specificity, and allow its activity to be responsive to extracellular signals. Several targeting subunits of PP1 have been identified, including PPP1R5, the glycogen-binding subunits PPP1R3 and PPP1R4, and the nuclear inhibitor of PP1.
Product Categories/Family for anti-PPP1R3C antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
protein phosphatase 1 regulatory subunit 3C
NCBI Official Synonym Full Names
protein phosphatase 1 regulatory subunit 3C
NCBI Official Symbol
PPP1R3C
NCBI Official Synonym Symbols
PTG; PPP1R5
NCBI Protein Information
protein phosphatase 1 regulatory subunit 3C
UniProt Protein Name
Protein phosphatase 1 regulatory subunit 3C
UniProt Gene Name
PPP1R3C
UniProt Synonym Gene Names
PPP1R5; PP1 subunit R5; PTG
UniProt Entry Name
PPR3C_HUMAN

NCBI Description

This gene encodes a carbohydrate binding protein that is a subunit of the protein phosphatase 1 (PP1) complex. PP1 catalyzes reversible protein phosphorylation, which is important in a wide range of cellular activities. The encoded protein affects glycogen biosynthesis by activating glycogen synthase and limiting glycogen breakdown by reducing glycogen phosphorylase activity. DNA hypermethylation of this gene has been found in colorectal cancer patients. The encoded protein also interacts with the laforin protein, which is a protein tyrosine phosphatase implicated in Lafora disease. [provided by RefSeq, Sep 2016]

Uniprot Description

PPP1R3C: Acts as a glycogen-targeting subunit for PP1 and regulates its activity. Activates glycogen synthase, reduces glycogen phosphorylase activity and limits glycogen breakdown. Dramatically increases basal and insulin-stimulated glycogen synthesis upon overexpression in a variety of cell types.

Protein type: Protein phosphatase, regulatory subunit; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 10q23-q24

Cellular Component: cytosol

Molecular Function: protein binding; protein serine/threonine phosphatase activity; protein phosphatase binding

Biological Process: glycogen biosynthetic process; dephosphorylation; carbohydrate metabolic process; glucose metabolic process; pathogenesis

Research Articles on PPP1R3C

Similar Products

Product Notes

The PPP1R3C ppp1r3c (Catalog #AAA3215788) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PPP1R3C antibody - N-terminal region reacts with Dog, Horse, Human, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's PPP1R3C can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PPP1R3C ppp1r3c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PPVKSFLGPY DEFQRRHFVN KLKPLKSCLN IKHKAKSQND WKCSHNQAKK. It is sometimes possible for the material contained within the vial of "PPP1R3C, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.