Western Blot (WB)
(Host: RabbitTarget Name: PPP1R18Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Rabbit PPP1R18 Polyclonal Antibody | anti-PPP1R18 antibody
PPP1R18 Antibody - C-terminal region
Gene Names
PPP1R18; HKMT1098; KIAA1949
Reactivity
Cow, Horse, Human, Pig, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PPP1R18; Polyclonal Antibody; PPP1R18 Antibody - C-terminal region; anti-PPP1R18 antibody
Host
Rabbit
Reactivity
Cow, Horse, Human, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PEDAGTGGLRQQEEEAVELQPPPPAPLSPPPPAPTAPQPPGDPLMSRLFY
Sequence Length
613
Applicable Applications for anti-PPP1R18 antibody
Western Blot (WB)
Homology
Cow: 79%; Horse: 86%; Human: 100%; Pig: 93%; Rabbit: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human PPP1R18
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: PPP1R18Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: PPP1R18Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-PPP1R18 antibody
This is a rabbit polyclonal antibody against PPP1R18. It was validated on Western Blot
Target Description: Protein phosphatase-1 interacts with regulatory subunits that target the enzyme to different cellular locations and change its activity toward specific substrates. Phostensin is a regulatory subunit that targets PP1 to F-actin cytoskeleton.
Target Description: Protein phosphatase-1 interacts with regulatory subunits that target the enzyme to different cellular locations and change its activity toward specific substrates. Phostensin is a regulatory subunit that targets PP1 to F-actin cytoskeleton.
Product Categories/Family for anti-PPP1R18 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
68kDa
NCBI Official Full Name
phostensin
NCBI Official Synonym Full Names
protein phosphatase 1 regulatory subunit 18
NCBI Official Symbol
PPP1R18
NCBI Official Synonym Symbols
HKMT1098; KIAA1949
NCBI Protein Information
phostensin
UniProt Protein Name
Phostensin
Protein Family
UniProt Gene Name
PPP1R18
UniProt Synonym Gene Names
HKMT1098; KIAA1949
NCBI Description
Protein phosphatase-1 (PP1; see MIM 176875) interacts with regulatory subunits that target the enzyme to different cellular locations and change its activity toward specific substrates. Phostensin is a regulatory subunit that targets PP1 to F-actin (see MIM 102610) cytoskeleton (Kao et al., 2007 [PubMed 17374523]).[supplied by OMIM, Mar 2008]
Uniprot Description
PPP1R18: May target protein phosphatase 1 to F-actin cytoskeleton. 2 isoforms of the human protein are produced by alternative splicing.
Chromosomal Location of Human Ortholog: 6p21.33
Cellular Component: cytoplasm; cytoskeleton
Molecular Function: actin binding; phosphatase binding; protein binding
Research Articles on PPP1R18
Similar Products
Product Notes
The PPP1R18 ppp1r18 (Catalog #AAA3210859) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PPP1R18 Antibody - C-terminal region reacts with Cow, Horse, Human, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's PPP1R18 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PPP1R18 ppp1r18 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PEDAGTGGLR QQEEEAVELQ PPPPAPLSPP PPAPTAPQPP GDPLMSRLFY. It is sometimes possible for the material contained within the vial of "PPP1R18, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
