Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of PPP1R12B expression in transfected 293T cell line) by PPP1R12B polyclonal antibody. Lane 1: PPP1R12B transfected lysate (43.3kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human PPP1R12B Polyclonal Antibody | anti-PPP1R12B antibody

PPP1R12B (Protein Phosphatase 1 Regulatory Subunit 12B, Myosin Phosphatase-targeting Subunit 2, Myosin Phosphatase Target Subunit 2, MYPT2, MGC131980, MGC87886)

Gene Names
PPP1R12B; MYPT2; PP1bp55
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
PPP1R12B; Polyclonal Antibody; PPP1R12B (Protein Phosphatase 1 Regulatory Subunit 12B; Myosin Phosphatase-targeting Subunit 2; Myosin Phosphatase Target Subunit 2; MYPT2; MGC131980; MGC87886); Anti -PPP1R12B (Protein Phosphatase 1 Regulatory Subunit 12B; anti-PPP1R12B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human PPP1R12B.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MAELEHLGGKRAESARMRRAEQLRRWRGSLTEQEPAERRGAGRQPLTRRGSPRVRFEDGAVFLAACSSGDTDEVRKLLARGADINTVNVDGLTALHQACIDENLDMVKFLVENRANVNQQDNEGWTPLHAAASCGYLNIAEYFINHGASVGIVNSEGEVPSDLAEEPAMKDLLLEQVKKQGVDLEQSRKEEEQQMLQDARQWLNSGKIEDVRQARSGATALHVAAAKGYSEVLRLLIQAGYELNVQDYDGWTPLHAAAHWGVKEACSILAEALCDMDIRNKLGQTPFDVADEGLVEHLELLQKKQNVLRSEKETRNKLIESDLNSKIQSGFFKNKEKMLYEEETPKSQEMEEENKESSSSSSEEEEGEDEASESETEKEAVLFWPF
Applicable Applications for anti-PPP1R12B antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human PPP1R12B, aa1-386.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of PPP1R12B expression in transfected 293T cell line) by PPP1R12B polyclonal antibody. Lane 1: PPP1R12B transfected lysate (43.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PPP1R12B expression in transfected 293T cell line) by PPP1R12B polyclonal antibody. Lane 1: PPP1R12B transfected lysate (43.3kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-PPP1R12B antibody
Regulates myosin phosphatase activity. Augments Ca2+ sensitivity of the contractile apparatus.
Product Categories/Family for anti-PPP1R12B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
110,404 Da
NCBI Official Full Name
protein phosphatase 1 regulatory subunit 12B isoform d
NCBI Official Synonym Full Names
protein phosphatase 1, regulatory subunit 12B
NCBI Official Symbol
PPP1R12B
NCBI Official Synonym Symbols
MYPT2; PP1bp55
NCBI Protein Information
protein phosphatase 1 regulatory subunit 12B; myosin phosphatase target subunit 2; myosin phosphatase, target subunit 2; myosin phosphatase-targeting subunit 2; protein phosphatase 1, regulatory (inhibitor) subunit 12B
UniProt Protein Name
Protein phosphatase 1 regulatory subunit 12B
UniProt Gene Name
PPP1R12B
UniProt Synonym Gene Names
MYPT2; Myosin phosphatase target subunit 2
UniProt Entry Name
MYPT2_HUMAN

NCBI Description

Myosin phosphatase is a protein complex comprised of three subunits: a catalytic subunit (PP1c-delta, protein phosphatase 1, catalytic subunit delta), a large regulatory subunit (MYPT, myosin phosphatase target) and small regulatory subunit (sm-M20). Two isoforms of MYPT have been isolated--MYPT1 and MYPT2, the first of which is widely expressed, and the second of which may be specific to heart, skeletal muscle, and brain. Each of the MYPT isoforms functions to bind PP1c-delta and increase phosphatase activity. This locus encodes both MYTP2 and M20. Alternatively spliced transcript variants encoding different isoforms have been identified. Related pseudogenes have been defined on the Y chromosome. [provided by RefSeq, Oct 2011]

Uniprot Description

PPP1R12B: Regulates myosin phosphatase activity. Augments Ca(2+) sensitivity of the contractile apparatus. 5 isoforms of the human protein are produced by alternative promoter.

Protein type: Motility/polarity/chemotaxis; Protein phosphatase, regulatory subunit; Activator

Chromosomal Location of Human Ortholog: 1q32.1

Cellular Component: nucleoplasm; cytoplasm

Molecular Function: enzyme activator activity

Biological Process: positive regulation of catalytic activity; regulation of muscle contraction; mitotic cell cycle; G2/M transition of mitotic cell cycle; signal transduction

Research Articles on PPP1R12B

Similar Products

Product Notes

The PPP1R12B ppp1r12b (Catalog #AAA6009352) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PPP1R12B (Protein Phosphatase 1 Regulatory Subunit 12B, Myosin Phosphatase-targeting Subunit 2, Myosin Phosphatase Target Subunit 2, MYPT2, MGC131980, MGC87886) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PPP1R12B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the PPP1R12B ppp1r12b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAELEHLGGK RAESARMRRA EQLRRWRGSL TEQEPAERRG AGRQPLTRRG SPRVRFEDGA VFLAACSSGD TDEVRKLLAR GADINTVNVD GLTALHQACI DENLDMVKFL VENRANVNQQ DNEGWTPLHA AASCGYLNIA EYFINHGASV GIVNSEGEVP SDLAEEPAMK DLLLEQVKKQ GVDLEQSRKE EEQQMLQDAR QWLNSGKIED VRQARSGATA LHVAAAKGYS EVLRLLIQAG YELNVQDYDG WTPLHAAAHW GVKEACSILA EALCDMDIRN KLGQTPFDVA DEGLVEHLEL LQKKQNVLRS EKETRNKLIE SDLNSKIQSG FFKNKEKMLY EEETPKSQEM EEENKESSSS SSEEEEGEDE ASESETEKEA VLFWPF. It is sometimes possible for the material contained within the vial of "PPP1R12B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.