Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ASIPSample Tissue: Human PANC1 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human ASIP Polyclonal Antibody | anti-ASIP antibody

ASIP Antibody - middle region

Gene Names
ASIP; ASP; AGSW; AGTI; AGTIL; SHEP9
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
ASIP; Polyclonal Antibody; ASIP Antibody - middle region; anti-ASIP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CFFTANSHLPPEEKLRDDRSLRSNSSVNLLDVPSVSIVALNKKSKQIGRK
Sequence Length
132
Applicable Applications for anti-ASIP antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ASIP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ASIPSample Tissue: Human PANC1 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ASIPSample Tissue: Human PANC1 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-ASIP antibody
In mice, the agouti gene encodes a paracrine signaling molecule that causes hair follicle melanocytes to synthesize pheomelanin, a yellow pigment, instead of the black or brown pigment, eumelanin. Pleiotropic effects of constitutive expression of the mouse gene include adult-onset obesity, increased tumor susceptibility, and premature infertility. This gene is highly similar to the mouse gene and encodes a secreted protein that may (1) affect the quality of hair pigmentation, (2) act as a pharmacological antagonist of alpha-melanocyte-stimulating hormone, (3) play a role in neuroendocrine aspects of melanocortin action, and (4) have a functional role in regulating lipid metabolism in adipocytes.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
434
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14 kDa
NCBI Official Full Name
agouti-signaling protein
NCBI Official Synonym Full Names
agouti signaling protein
NCBI Official Symbol
ASIP
NCBI Official Synonym Symbols
ASP; AGSW; AGTI; AGTIL; SHEP9
NCBI Protein Information
agouti-signaling protein
UniProt Protein Name
Agouti-signaling protein
Protein Family
UniProt Gene Name
ASIP
UniProt Synonym Gene Names
AGTI; AGTIL; ASP; ASP
UniProt Entry Name
ASIP_HUMAN

NCBI Description

In mice, the agouti gene encodes a paracrine signaling molecule that causes hair follicle melanocytes to synthesize pheomelanin, a yellow pigment, instead of the black or brown pigment, eumelanin. Pleiotropic effects of constitutive expression of the mouse gene include adult-onset obesity, increased tumor susceptibility, and premature infertility. This gene is highly similar to the mouse gene and encodes a secreted protein that may (1) affect the quality of hair pigmentation, (2) act as a pharmacological antagonist of alpha-melanocyte-stimulating hormone, (3) play a role in neuroendocrine aspects of melanocortin action, and (4) have a functional role in regulating lipid metabolism in adipocytes. [provided by RefSeq, Jul 2008]

Uniprot Description

ASIP: Involved in the regulation of melanogenesis. The binding of ASP to MC1R precludes alpha-MSH initiated signaling and thus blocks production of cAMP, leading to a down-regulation of eumelanogenesis (brown/black pigment) and thus increasing synthesis of pheomelanin (yellow/red pigment). In higher primates, agouti may affect the quality of hair pigmentation rather than its pattern of deposition. Could well play a role in neuroendocrine aspects of melanocortin action. May have some functional role in regulating the lipid metabolism with adipocytes.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 20q11.2-q12

Cellular Component: extracellular space

Molecular Function: type 3 melanocortin receptor binding; type 4 melanocortin receptor binding; receptor binding

Biological Process: melanin biosynthetic process; generation of precursor metabolites and energy; regulation of molecular function, epigenetic; hormone-mediated signaling; cell-cell signaling; melanosome organization and biogenesis; adult feeding behavior; signal transduction; melanosome transport

Disease: Skin/hair/eye Pigmentation, Variation In, 9

Research Articles on ASIP

Similar Products

Product Notes

The ASIP asip (Catalog #AAA3221613) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ASIP Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ASIP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ASIP asip for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CFFTANSHLP PEEKLRDDRS LRSNSSVNLL DVPSVSIVAL NKKSKQIGRK. It is sometimes possible for the material contained within the vial of "ASIP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.