Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PPM1FSample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human PPM1F Polyclonal Antibody | anti-PPM1F antibody

PPM1F Antibody - C-terminal region

Gene Names
PPM1F; CAMKP; FEM-2; POPX2; hFEM-2; CaMKPase
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
PPM1F; Polyclonal Antibody; PPM1F Antibody - C-terminal region; anti-PPM1F antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NITVMVVFLRDPQELLEGGNQGEGDPQAEGRRQDLPSSLPEPETQAPPRS
Sequence Length
454
Applicable Applications for anti-PPM1F antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of Human PPM1F
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PPM1FSample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PPM1FSample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-PPM1F antibody
The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase can interact with Rho guanine nucleotide exchange factors (PIX), and thus block the effects of p21-activated kinase 1 (PAK), a protein kinase mediating biological effects downstream of Rho GTPases. Calcium/calmodulin-dependent protein kinase II gamma (CAMK2G/CAMK-II) is found to be one of the substrates of this phosphatase. The overexpression of this phosphatase or CAMK2G has been shown to mediate caspase-dependent apoptosis. An alternatively spliced transcript variant has been identified, but its full-length nature has not been determined.
Product Categories/Family for anti-PPM1F antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49 kDa
NCBI Official Full Name
protein phosphatase 1F
NCBI Official Synonym Full Names
protein phosphatase, Mg2+/Mn2+ dependent 1F
NCBI Official Symbol
PPM1F
NCBI Official Synonym Symbols
CAMKP; FEM-2; POPX2; hFEM-2; CaMKPase
NCBI Protein Information
protein phosphatase 1F
UniProt Protein Name
Protein phosphatase 1F
Protein Family
UniProt Gene Name
PPM1F
UniProt Synonym Gene Names
KIAA0015; POPX2; CaM-kinase phosphatase; CaMKPase; hFem-2
UniProt Entry Name
PPM1F_HUMAN

NCBI Description

The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase can interact with Rho guanine nucleotide exchange factors (PIX), and thus block the effects of p21-activated kinase 1 (PAK), a protein kinase mediating biological effects downstream of Rho GTPases. Calcium/calmodulin-dependent protein kinase II gamma (CAMK2G/CAMK-II) is found to be one of the substrates of this phosphatase. The overexpression of this phosphatase or CAMK2G has been shown to mediate caspase-dependent apoptosis. An alternatively spliced transcript variant has been identified, but its full-length nature has not been determined. [provided by RefSeq, Jul 2008]

Uniprot Description

PPM1F: a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members can be negative regulators of cell stress response pathways. Interact with PAK-interacting exchange factor beta (ARHGEF7), blocking the effects PAK1, a protein kinase mediating biological effects downstream of Rho GTPases. Calcium/calmodulin-dependent protein kinase II gamma (CaMK2-gamma) is one of the substrates of this phosphatase. Promotes apoptosis.

Protein type: Motility/polarity/chemotaxis; EC 3.1.3.16; Protein phosphatase, dual-specificity

Chromosomal Location of Human Ortholog: 22q11.22

Cellular Component: protein complex; perinuclear region of cytoplasm; cytosol

Molecular Function: protein binding; calmodulin-dependent protein phosphatase activity; metal ion binding; phosphoric monoester hydrolase activity; protein serine/threonine phosphatase activity

Biological Process: histone dephosphorylation; positive regulation of focal adhesion formation; positive regulation of chemotaxis; positive regulation of stress fiber formation; negative regulation of peptidyl-serine phosphorylation; positive regulation of caspase activity; negative regulation of protein kinase activity; negative regulation of transcription, DNA-dependent; positive regulation of growth

Research Articles on PPM1F

Similar Products

Product Notes

The PPM1F ppm1f (Catalog #AAA3222723) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PPM1F Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PPM1F can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PPM1F ppm1f for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NITVMVVFLR DPQELLEGGN QGEGDPQAEG RRQDLPSSLP EPETQAPPRS. It is sometimes possible for the material contained within the vial of "PPM1F, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.