Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-PPAP2B Polyclonal Antibody)

Rabbit PPAP2B Polyclonal Antibody | anti-PPAP2B antibody

PPAP2B Polyclonal Antibody

Gene Names
PLPP3; LPP3; VCIP; Dri42; PAP2B; PPAP2B
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purification
Synonyms
PPAP2B; Polyclonal Antibody; PPAP2B Polyclonal Antibody; PLPP3; Dri42; LPP3; PAP2B; VCIP; phospholipid phosphatase 3; anti-PPAP2B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
3.14 mg/ml (varies by lot)
Sequence Length
311
Applicable Applications for anti-PPAP2B antibody
Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
WB: 1:500-1:2000
IHC: 1:100-1:200
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PPAP2B (NP_003704.3).
Immunogen Sequence
MQNYKYDKAIVPESKNGGSPALNNNPRRSGSKRVLLICLDLFCLFMAGLPFLIIETSTIKPYHRGFYCNDESIKYPLKTGETINDAVLCAVGIVIAILAI
Positive Samples
HeLa, LO2, MCF7, Mouse Brain, Mouse Kidney, Rat Lung, Rat Brain
Cellular Location
Cell Membrane, Golgi Apparatus, Multi-Pass Membrane Protein, Trans-Golgi Network Membrane
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-PPAP2B Polyclonal Antibody)

Western Blot (WB) (Western blot-PPAP2B Polyclonal Antibody)
Related Product Information for anti-PPAP2B antibody
The protein encoded by this gene is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in de novo synthesis of glycerolipids as well as in receptor-activated signal transduction mediated by phospholipase D. This protein is a membrane glycoprotein localized at the cell plasma membrane. It has been shown to actively hydrolyze extracellular lysophosphatidic acid and short-chain phosphatidic acid. The expression of this gene is found to be enhanced by epidermal growth factor in Hela cells.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 35kDa
Observed: 38kDa
NCBI Official Full Name
phospholipid phosphatase 3
NCBI Official Synonym Full Names
phospholipid phosphatase 3
NCBI Official Symbol
PLPP3
NCBI Official Synonym Symbols
LPP3; VCIP; Dri42; PAP2B; PPAP2B
NCBI Protein Information
phospholipid phosphatase 3
UniProt Protein Name
Lipid phosphate phosphohydrolase 3
UniProt Gene Name
PPAP2B
UniProt Synonym Gene Names
LPP3; PAP-2b; PAP2b; VCIP
UniProt Entry Name
LPP3_HUMAN

NCBI Description

The protein encoded by this gene is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in de novo synthesis of glycerolipids as well as in receptor-activated signal transduction mediated by phospholipase D. This protein is a membrane glycoprotein localized at the cell plasma membrane. It has been shown to actively hydrolyze extracellular lysophosphatidic acid and short-chain phosphatidic acid. The expression of this gene is found to be enhanced by epidermal growth factor in Hela cells. [provided by RefSeq, Mar 2010]

Uniprot Description

PPAP2B: Catalyzes the conversion of phosphatidic acid (PA) to diacylglycerol (DG). In addition it hydrolyzes lysophosphatidic acid (LPA), ceramide-1-phosphate (C-1-P) and sphingosine-1- phosphate (S-1-P). The relative catalytic efficiency is LPA = PA > C-1-P > S-1-P. May be involved in cell adhesion and in cell-cell interactions. Belongs to the PA-phosphatase related phosphoesterase family.

Protein type: Membrane protein, integral; Lipid Metabolism - glycerolipid; Lipid Metabolism - ether lipid; Lipid Metabolism - sphingolipid; Lipid Metabolism - glycerophospholipid; Membrane protein, multi-pass; Motility/polarity/chemotaxis; EC 3.1.3.4; Phosphatase, lipid

Chromosomal Location of Human Ortholog: 1p32.2

Cellular Component: Golgi apparatus; adherens junction; membrane; plasma membrane; integral to membrane

Molecular Function: integrin binding; protein binding; phosphatidate phosphatase activity; lipid phosphatase activity; phosphoprotein phosphatase activity; sphingosine-1-phosphate phosphatase activity

Biological Process: blood vessel development; sphingolipid metabolic process; sphingolipid biosynthetic process; protein stabilization; regulation of Wnt receptor signaling pathway; gastrulation with mouth forming second; Bergmann glial cell differentiation; positive regulation of peptidyl-tyrosine phosphorylation; dephosphorylation; negative regulation of protein amino acid phosphorylation; phospholipid metabolic process; germ cell migration; homotypic cell-cell adhesion; positive regulation of transcription factor activity; lipid metabolic process

Research Articles on PPAP2B

Similar Products

Product Notes

The PPAP2B ppap2b (Catalog #AAA9140468) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PPAP2B Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PPAP2B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). WB: 1:500-1:2000 IHC: 1:100-1:200. Researchers should empirically determine the suitability of the PPAP2B ppap2b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PPAP2B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.