Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human POR Polyclonal Antibody | anti-POR antibody

Anti-Human POR DyLight 550 conjugated Antibody

Gene Names
POR; CPR; CYPOR; P450R
Reactivity
Human
Applications
Flow Cytometry, Functional Assay
Purity
Immunogen Affinity Purified
Synonyms
POR; Polyclonal Antibody; Anti-Human POR DyLight 550 conjugated Antibody; Rabbit IgG Polyclonal Anti-Human POR Antibody DyLight 550 Conjugated; Flow Validated; NADPH--cytochrome P450 reductase; P450 (cytochrome) oxidoreductase; anti-POR antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
No cross reactivity with other proteins.
Purity/Purification
Immunogen Affinity Purified
Form/Format
Liquid
Sequence Length
677
Applicable Applications for anti-POR antibody
Flow Cytometry (FC/FACS)
Application Notes
FC/FACS: 1-3ug/1x106 cells
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human POR (633-668aa RNMARDVQNTFYDIVAELGAMEHAQAVDYIKKLMTK), different from the related mouse and rat sequences by five amino acids.
Preparation and Storage
Store at 2-8 degree C for one year. Protect from light. Do not freeze.
Related Product Information for anti-POR antibody
POR is a membrane-boundenzyme required for electron transfer from NADPH to cytochrome P450 in the endoplasmic reticulum of theeukaryotic cell. The gene encodes an endoplasmic reticulum membrane oxidoreductase with an FAD-binding domain and a flavodoxin-like domain. The protein binds two cofactors, FAD and FMN, which allow it to donate electrons directly from NADPH to all microsomal P450 enzymes. Mutations in this gene have been associated with various diseases, including apparent combined P450C17 and P450C21 deficiency, amenorrhea and disordered steroidogenesis, congenital adrenal hyperplasia and Antley-Bixler syndrome.
References
1. Adachi, M., Asakura, Y., Matsuo, M., Yamamoto, T., Hanaki, K., Arlt, W. POR R457H is a global founder mutation causing Antley-Bixler syndrome with autosomal recessive trait. (Letter) Am. J. Med. Genet. 140A: 633-635, 2006. 2. Miller, W. L. Congenital adrenal hyperplasia. (Letter) New Eng. J. Med. 314: 1321-1322, 1986. 3. Shephard, E. A., Phillips, I. R., Santisteban, I., West, L. F., Palmer, C. N., Ashworth, A., Povey, S. Isolation of a human cytochrome P-450 reductase cDNA clone and localization of the corresponding gene to chromosome 7q11.2. Ann. Hum. Genet. 53: 291-301, 1989.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
76,690 Da
NCBI Official Full Name
NADPH--cytochrome P450 reductase
NCBI Official Synonym Full Names
cytochrome p450 oxidoreductase
NCBI Official Symbol
POR
NCBI Official Synonym Symbols
CPR; CYPOR; P450R
NCBI Protein Information
NADPH--cytochrome P450 reductase
UniProt Protein Name
NADPH--cytochrome P450 reductase
Protein Family
UniProt Gene Name
POR
UniProt Synonym Gene Names
CYPOR; CPR

NCBI Description

This gene encodes an endoplasmic reticulum membrane oxidoreductase with an FAD-binding domain and a flavodoxin-like domain. The protein binds two cofactors, FAD and FMN, which allow it to donate electrons directly from NADPH to all microsomal P450 enzymes. Mutations in this gene have been associated with various diseases, including apparent combined P450C17 and P450C21 deficiency, amenorrhea and disordered steroidogenesis, congenital adrenal hyperplasia and Antley-Bixler syndrome. [provided by RefSeq, Jul 2008]

Uniprot Description

This enzyme is required for electron transfer from NADP to cytochrome P450 in microsomes. It can also provide electron transfer to heme oxygenase and cytochrome B5.

Research Articles on POR

Similar Products

Product Notes

The POR por (Catalog #AAA1751407) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-Human POR DyLight 550 conjugated Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's POR can be used in a range of immunoassay formats including, but not limited to, Flow Cytometry (FC/FACS). FC/FACS: 1-3ug/1x106 cells. Researchers should empirically determine the suitability of the POR por for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "POR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.