Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: POLR3GSample Type: COLO205 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human POLR3G Polyclonal Antibody | anti-POLR3G antibody

POLR3G Antibody - middle region

Gene Names
POLR3G; RPC7; RPC32
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
POLR3G; Polyclonal Antibody; POLR3G Antibody - middle region; anti-POLR3G antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SKRYMKVYKEEWIPDWRRLPREMMPRNKCKKAGPKPKKAKDAGKGTPLTN
Sequence Length
223
Applicable Applications for anti-POLR3G antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human POLR3G
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: POLR3GSample Type: COLO205 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: POLR3GSample Type: COLO205 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-POLR3G antibody
This is a rabbit polyclonal antibody against POLR3G. It was validated on Western Blot

Target Description: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. POLR3G is a specific peripheric component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. It may direct with other members of the RPC3/POLR3C-RPC6/POLR3F-RPC7/POLR3G subcomplex RNA Pol III binding to the TFIIIB-DNA complex via the interactions between TFIIIB and POLR3F. It may be involved either in the recruitment and stabilization of the subcomplex within RNA polymerase III, or in stimulating catalytic functions of other subunits during initiation. POLR3G plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. POLR3G acts as nuclear and cytosolic DNA sensor involved in innate immune response. POLR3G can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs) induce type I interferon and NF- Kappa-B through the RIG-I pathway.
Product Categories/Family for anti-POLR3G antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26kDa
NCBI Official Full Name
DNA-directed RNA polymerase III subunit RPC7
NCBI Official Synonym Full Names
RNA polymerase III subunit G
NCBI Official Symbol
POLR3G
NCBI Official Synonym Symbols
RPC7; RPC32
NCBI Protein Information
DNA-directed RNA polymerase III subunit RPC7
UniProt Protein Name
DNA-directed RNA polymerase III subunit RPC7
UniProt Gene Name
POLR3G
UniProt Synonym Gene Names
RNA polymerase III subunit C7; RPC32
UniProt Entry Name
RPC7_HUMAN

Research Articles on POLR3G

Similar Products

Product Notes

The POLR3G polr3g (Catalog #AAA3217858) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The POLR3G Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's POLR3G can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the POLR3G polr3g for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SKRYMKVYKE EWIPDWRRLP REMMPRNKCK KAGPKPKKAK DAGKGTPLTN. It is sometimes possible for the material contained within the vial of "POLR3G, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.