Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human POLR2L Polyclonal Antibody | anti-POLR2L antibody

POLR2L (DNA-directed RNA Polymerases I, II, and III Subunit RPABC5, RNA Polymerases I, II, and III Subunit ABC5, DNA-directed RNA Polymerase III Subunit L, RNA Polymerase II 7.6kD Subunit, RPB7.6, RPB10 Homolog) (MaxLight 490)

Gene Names
POLR2L; RBP10; RPB10; RPABC5; RPB7.6; hRPB7.6; RPB10beta
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
POLR2L; Polyclonal Antibody; POLR2L (DNA-directed RNA Polymerases I; II; and III Subunit RPABC5; RNA Polymerases I; and III Subunit ABC5; DNA-directed RNA Polymerase III Subunit L; RNA Polymerase II 7.6kD Subunit; RPB7.6; RPB10 Homolog) (MaxLight 490); anti-POLR2L antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human POLR2L.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Applicable Applications for anti-POLR2L antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human POLR2L, aa1-422 (NP_066951.1).
Immunogen Sequence
MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK
Conjugate
MaxLight490
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-POLR2L antibody
DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and a small RNAs, such as 5S rRNA and tRNAs, respectively. Pol II is the central component of the basal RNA polymerase II transcription machinery. Pols are composed of mobile elements that move relative to each other. In Pol II, POLR2L/RBP10 is part of the core element with the central large cleft.
Product Categories/Family for anti-POLR2L antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
7,645 Da
NCBI Official Full Name
DNA-directed RNA polymerases I, II, and III subunit RPABC5
NCBI Official Synonym Full Names
polymerase (RNA) II (DNA directed) polypeptide L, 7.6kDa
NCBI Official Symbol
POLR2L
NCBI Official Synonym Symbols
RBP10; RPB10; RPABC5; RPB7.6; hRPB7.6; RPB10beta
NCBI Protein Information
DNA-directed RNA polymerases I, II, and III subunit RPABC5; RPB10 homolog; RNA polymerase II 7.6 kDa subunit; DNA-directed RNA polymerase III subunit L; RNA polymerases I, II, and III subunit ABC5
UniProt Protein Name
DNA-directed RNA polymerases I, II, and III subunit RPABC5
UniProt Gene Name
POLR2L
UniProt Synonym Gene Names
RNA polymerases I, II, and III subunit ABC5; RPB7.6
UniProt Entry Name
RPAB5_HUMAN

Uniprot Description

POLR2L: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and a small RNAs, such as 5S rRNA and tRNAs, respectively. Pol II is the central component of the basal RNA polymerase II transcription machinery. Pols are composed of mobile elements that move relative to each other. In Pol II, POLR2L/RBP10 is part of the core element with the central large cleft. Belongs to the archaeal RpoN/eukaryotic RPB10 RNA polymerase subunit family.

Protein type: EC 2.7.7.6; Transcription initiation complex; Transferase; Nucleotide Metabolism - pyrimidine; DNA-binding; Nucleotide Metabolism - purine

Chromosomal Location of Human Ortholog: 11p15

Cellular Component: nucleoplasm; DNA-directed RNA polymerase III complex; DNA-directed RNA polymerase II, core complex; nucleus; cytosol; DNA-directed RNA polymerase I complex

Molecular Function: DNA binding; zinc ion binding; DNA-directed RNA polymerase activity

Biological Process: transcription from RNA polymerase II promoter; transcription initiation from RNA polymerase II promoter; regulation of transcription from RNA polymerase I promoter; termination of RNA polymerase III transcription; viral reproduction; positive regulation of viral transcription; somatic stem cell maintenance; RNA splicing; RNA elongation from RNA polymerase I promoter; transcription from RNA polymerase I promoter; termination of RNA polymerase I transcription; DNA repair; regulation of gene expression, epigenetic; nuclear mRNA splicing, via spliceosome; transcription from RNA polymerase III promoter; mRNA capping; nucleotide-excision repair; negative regulation of gene expression, epigenetic; transcription-coupled nucleotide-excision repair; RNA elongation from RNA polymerase II promoter; positive regulation of interferon type I production; innate immune response; gene expression; transcription initiation from RNA polymerase I promoter; RNA elongation from RNA polymerase III promoter

Similar Products

Product Notes

The POLR2L polr2l (Catalog #AAA6390159) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The POLR2L (DNA-directed RNA Polymerases I, II, and III Subunit RPABC5, RNA Polymerases I, II, and III Subunit ABC5, DNA-directed RNA Polymerase III Subunit L, RNA Polymerase II 7.6kD Subunit, RPB7.6, RPB10 Homolog) (MaxLight 490) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's POLR2L can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the POLR2L polr2l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "POLR2L, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.