Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-POLR2K Antibody Titration: 0.2-1 ug/mlPositive Control: Human brain)

Rabbit POLR2K Polyclonal Antibody | anti-POLR2K antibody

POLR2K antibody - middle region

Gene Names
POLR2K; RPB12; RPABC4; RPB7.0; hRPB7.0; hsRPB10a; RPB10alpha; ABC10-alpha
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
POLR2K; Polyclonal Antibody; POLR2K antibody - middle region; anti-POLR2K antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKR
Sequence Length
58
Applicable Applications for anti-POLR2K antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human POLR2K
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-POLR2K Antibody Titration: 0.2-1 ug/mlPositive Control: Human brain)

Western Blot (WB) (WB Suggested Anti-POLR2K Antibody Titration: 0.2-1 ug/mlPositive Control: Human brain)
Related Product Information for anti-POLR2K antibody
This is a rabbit polyclonal antibody against POLR2K. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: POLR2K is one of the smallest subunits of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. This subunit is shared by the other two DNA-directed RNA polymerases.This gene encodes one of the smallest subunits of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. This subunit is shared by the other two DNA-directed RNA polymerases. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-POLR2K antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
7kDa
NCBI Official Full Name
DNA-directed RNA polymerases I, II, and III subunit RPABC4
NCBI Official Synonym Full Names
RNA polymerase II subunit K
NCBI Official Symbol
POLR2K
NCBI Official Synonym Symbols
RPB12; RPABC4; RPB7.0; hRPB7.0; hsRPB10a; RPB10alpha; ABC10-alpha
NCBI Protein Information
DNA-directed RNA polymerases I, II, and III subunit RPABC4
UniProt Protein Name
DNA-directed RNA polymerases I, II, and III subunit RPABC4
UniProt Gene Name
POLR2K
UniProt Synonym Gene Names
RNA polymerases I, II, and III subunit ABC4; RPB7.0
UniProt Entry Name
RPAB4_HUMAN

NCBI Description

This gene encodes one of the smallest subunits of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. This subunit is shared by the other two DNA-directed RNA polymerases. [provided by RefSeq, Jul 2008]

Uniprot Description

POLR2K: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and a small RNAs, such as 5S rRNA and tRNAs, respectively. Belongs to the archaeal RpoP/eukaryotic RPC10 RNA polymerase subunit family.

Protein type: DNA repair, damage; RNA processing

Chromosomal Location of Human Ortholog: 8q22.2

Cellular Component: cytosol; DNA-directed RNA polymerase I complex; DNA-directed RNA polymerase II, core complex; DNA-directed RNA polymerase III complex; nucleoplasm; nucleus

Molecular Function: zinc ion binding

Biological Process: fibroblast growth factor receptor signaling pathway; gene expression; mRNA capping; nuclear mRNA splicing, via spliceosome; positive regulation of gene expression, epigenetic; positive regulation of interferon type I production; positive regulation of viral transcription; regulation of transcription from RNA polymerase I promoter; RNA elongation from RNA polymerase I promoter; RNA elongation from RNA polymerase II promoter; RNA-mediated gene silencing; snRNA transcription from RNA polymerase II promoter; somatic stem cell maintenance; termination of RNA polymerase I transcription; transcription from RNA polymerase II promoter; transcription from RNA polymerase III promoter; transcription initiation from RNA polymerase I promoter; transcription initiation from RNA polymerase II promoter; transcription-coupled nucleotide-excision repair

Research Articles on POLR2K

Similar Products

Product Notes

The POLR2K polr2k (Catalog #AAA3209109) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The POLR2K antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's POLR2K can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the POLR2K polr2k for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DTQKDVQPPK QQPMIYICGE CHTENEIKSR DPIRCRECGY RIMYKKRTKR. It is sometimes possible for the material contained within the vial of "POLR2K, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.