Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-POLR2I Antibody Titration: 0.2-1 ug/mlPositive Control: Human Placenta)

Rabbit POLR2I Polyclonal Antibody | anti-POLR2I antibody

POLR2I antibody - N-terminal region

Gene Names
POLR2I; RPB9; hRPB14.5
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
POLR2I; Polyclonal Antibody; POLR2I antibody - N-terminal region; anti-POLR2I antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EPDGTYEPGFVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNS
Sequence Length
125
Applicable Applications for anti-POLR2I antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Goat: 83%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human POLR2I
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-POLR2I Antibody Titration: 0.2-1 ug/mlPositive Control: Human Placenta)

Western Blot (WB) (WB Suggested Anti-POLR2I Antibody Titration: 0.2-1 ug/mlPositive Control: Human Placenta)
Related Product Information for anti-POLR2I antibody
This is a rabbit polyclonal antibody against POLR2I. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: POLR2I is a subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. This subunit, in combination with two other polymerase subunits, forms the DNA binding domain of the polymerase, a groove in which the DNA template is transcribed into RNA. POLR2I has two zinc finger motifs with conserved cysteines and the subunit does possess zinc binding activity.This gene encodes a subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. This subunit, in combination with two other polymerase subunits, forms the DNA binding domain of the polymerase, a groove in which the DNA template is transcribed into RNA. The product of this gene has two zinc finger motifs with conserved cysteines and the subunit does possess zinc binding activity. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14kDa
NCBI Official Full Name
DNA-directed RNA polymerase II subunit RPB9
NCBI Official Synonym Full Names
RNA polymerase II subunit I
NCBI Official Symbol
POLR2I
NCBI Official Synonym Symbols
RPB9; hRPB14.5
NCBI Protein Information
DNA-directed RNA polymerase II subunit RPB9
UniProt Protein Name
DNA-directed RNA polymerase II subunit RPB9
UniProt Gene Name
POLR2I
UniProt Synonym Gene Names
RNA polymerase II subunit B9; RPB14.5
UniProt Entry Name
RPB9_HUMAN

NCBI Description

This gene encodes a subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. This subunit, in combination with two other polymerase subunits, forms the DNA binding domain of the polymerase, a groove in which the DNA template is transcribed into RNA. The product of this gene has two zinc finger motifs with conserved cysteines and the subunit does possess zinc binding activity. [provided by RefSeq, Jul 2008]

Uniprot Description

POLR2I: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase II which synthesizes mRNA precursors and many functional non-coding RNAs. Pol II is the central component of the basal RNA polymerase II transcription machinery. It is composed of mobile elements that move relative to each other. RPB9 is part of the upper jaw surrounding the central large cleft and thought to grab the incoming DNA template. Belongs to the archaeal RpoM/eukaryotic RPA12/RPB9/RPC11 RNA polymerase family.

Protein type: Nucleotide Metabolism - pyrimidine; Transcription initiation complex; Transferase; Nucleotide Metabolism - purine; RNA processing; EC 2.7.7.6

Chromosomal Location of Human Ortholog: 19q12

Cellular Component: nucleoplasm; DNA-directed RNA polymerase II, core complex; nucleus

Molecular Function: DNA binding; zinc ion binding; DNA-directed RNA polymerase activity

Biological Process: nuclear mRNA splicing, via spliceosome; transcription from RNA polymerase II promoter; transcription initiation from RNA polymerase II promoter; mRNA capping; viral reproduction; nucleotide-excision repair; positive regulation of viral transcription; somatic stem cell maintenance; RNA splicing; transcription-coupled nucleotide-excision repair; RNA elongation from RNA polymerase II promoter; gene expression; DNA repair

Similar Products

Product Notes

The POLR2I polr2i (Catalog #AAA3204260) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The POLR2I antibody - N-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's POLR2I can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the POLR2I polr2i for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EPDGTYEPGF VGIRFCQECN NMLYPKEDKE NRILLYACRN CDYQQEADNS. It is sometimes possible for the material contained within the vial of "POLR2I, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.