Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunoprecipitation (IP) (Immunoprecipitation of POLR2H transfected lysate using POLR2H rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with POLR2H monoclonal antibody.)

Rabbit anti-Human POLR2H Polyclonal Antibody | anti-POLR2H antibody

POLR2H (DNA-directed RNA Polymerases I, II, and III Subunit RPABC3, DNA-directed RNA Polymerase II Subunit H, DNA-directed RNA Polymerases I, II, and III 17.1kD Polypeptide, RPB17, RPB8 Homolog)

Reactivity
Human
Applications
Immunoprecipitation
Purity
Serum
Serum
Synonyms
POLR2H; Polyclonal Antibody; POLR2H (DNA-directed RNA Polymerases I; II; and III Subunit RPABC3; DNA-directed RNA Polymerase II Subunit H; DNA-directed RNA Polymerases I; and III 17.1kD Polypeptide; RPB17; RPB8 Homolog); Anti -POLR2H (DNA-directed RNA Polymerases I; anti-POLR2H antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human POLR2H.
Purity/Purification
Serum
Serum
Form/Format
Supplied as a liquid.
Sequence
MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF
Applicable Applications for anti-POLR2H antibody
Immunoprecipitation (IP)
Application Notes
Suitable for use in Immunoprecipitation.
Immunogen
Full length human POLR2H, aa1-150 (NP_006223.2).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunoprecipitation (IP)

(Immunoprecipitation of POLR2H transfected lysate using POLR2H rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with POLR2H monoclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of POLR2H transfected lysate using POLR2H rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with POLR2H monoclonal antibody.)
Related Product Information for anti-POLR2H antibody
This gene encodes one of the essential subunits of RNA polymerase II that is shared by the other two eukaryotic DNA-directed RNA polymerases, I and III.
Product Categories/Family for anti-POLR2H antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
POLR2H protein
NCBI Official Synonym Full Names
polymerase (RNA) II (DNA directed) polypeptide H<
NCBI Official Symbol
POLR2H
NCBI Protein Information
DNA-directed RNA polymerases I, II, and III subunit RPABC3

Similar Products

Product Notes

The POLR2H (Catalog #AAA642924) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The POLR2H (DNA-directed RNA Polymerases I, II, and III Subunit RPABC3, DNA-directed RNA Polymerase II Subunit H, DNA-directed RNA Polymerases I, II, and III 17.1kD Polypeptide, RPB17, RPB8 Homolog) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's POLR2H can be used in a range of immunoassay formats including, but not limited to, Immunoprecipitation (IP). Suitable for use in Immunoprecipitation. Researchers should empirically determine the suitability of the POLR2H for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAGILFEDIF DVKDIDPEGK KFDRVSRLHC ESESFKMDLI LDVNIQIYPV DLGDKFRLVI ASTLYEDGTL DDGEYNPTDD RPSRADQFEY VMYGKVYRIE GDETSTEAAT RLSAYVSYGG LLMRLQGDAN NLHGFEVDSR VYLLMKKLAF. It is sometimes possible for the material contained within the vial of "POLR2H, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.