Western Blot (WB)
(WB Suggested Anti-POLR1D Antibody Titration: 0.2-1 ug/mlPositive Control: Human Lung)
Rabbit POLR1D Polyclonal Antibody | anti-POLR1D antibody
POLR1D antibody - middle region
Gene Names
POLR1D; AC19; RPA9; TCS2; RPA16; RPAC2; RPC16; POLR1C; RPO1-3
Reactivity
Cow, Dog, Human, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
POLR1D; Polyclonal Antibody; POLR1D antibody - middle region; anti-POLR1D antibody
Host
Rabbit
Reactivity
Cow, Dog, Human, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TRGTLPAVEPFQRGLNELMNVCQHVLDKFEASIKDYKDQKASRNESTF
Sequence Length
133
Applicable Applications for anti-POLR1D antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 93%; Human: 100%; Rabbit: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human POLR1D
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-POLR1D Antibody Titration: 0.2-1 ug/mlPositive Control: Human Lung)
Western Blot (WB)
(WB Suggested Anti-POLR1D Antibody Titration: 0.2-1 ug/mlPositive Control: Human Lung)
Related Product Information for anti-POLR1D antibody
This is a rabbit polyclonal antibody against POLR1D. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: POLR1D belongs to the archaeal rpoL/eukaryotic RPB11/RPC19 RNA polymerase subunit family. DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. POLR1D is the common core component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and tRNAs.
Target Description: POLR1D belongs to the archaeal rpoL/eukaryotic RPB11/RPC19 RNA polymerase subunit family. DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. POLR1D is the common core component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and tRNAs.
Product Categories/Family for anti-POLR1D antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
15kDa
NCBI Official Full Name
DNA-directed RNA polymerases I and III subunit RPAC2 isoform 1
NCBI Official Synonym Full Names
RNA polymerase I and III subunit D
NCBI Official Symbol
POLR1D
NCBI Official Synonym Symbols
AC19; RPA9; TCS2; RPA16; RPAC2; RPC16; POLR1C; RPO1-3
NCBI Protein Information
DNA-directed RNA polymerases I and III subunit RPAC2; Protein POLR1D
UniProt Protein Name
DNA-directed RNA polymerases I and III subunit RPAC2
Protein Family
UniProt Gene Name
POLR1D
UniProt Synonym Gene Names
RNA polymerases I and III subunit AC2; RPA16
UniProt Entry Name
RPAC2_HUMAN
NCBI Description
The protein encoded by this gene is a component of the RNA polymerase I and RNA polymerase III complexes, which function in the synthesis of ribosomal RNA precursors and small RNAs, respectively. Mutations in this gene are a cause of Treacher Collins syndrome (TCS), a craniofacial development disorder. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2011]
Research Articles on POLR1D
Similar Products
Product Notes
The POLR1D polr1d (Catalog #AAA3209167) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The POLR1D antibody - middle region reacts with Cow, Dog, Human, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's POLR1D can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the POLR1D polr1d for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TRGTLPAVEP FQRGLNELMN VCQHVLDKFE ASIKDYKDQK ASRNESTF. It is sometimes possible for the material contained within the vial of "POLR1D, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
