Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (PNLIPRP2 rabbit polyclonal antibody. Western Blot analysis of PNLIPRP2 expression in human pancreas.)

Rabbit anti-Human, Mouse PNLIPRP2 Polyclonal Antibody | anti-PNLIPRP2 antibody

PNLIPRP2 (Pancreatic Lipase-related Protein 2, PL-RP2, Galactolipase, PLRP2)

Gene Names
PNLIPRP2; PLRP2
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
PNLIPRP2; Polyclonal Antibody; PNLIPRP2 (Pancreatic Lipase-related Protein 2; PL-RP2; Galactolipase; PLRP2); Anti -PNLIPRP2 (Pancreatic Lipase-related Protein 2; anti-PNLIPRP2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human PNLIPRP2. Species Crossreactivity: mouse.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MLPPWTLGLLLLATVRGKEVCYGQLGCFSDEKPWAGTLQRPVKLLPWSPEDIDTRFLLYTNENPNNFQLITGTEPDTIEASNFQLDRKTRFIIHGFLDKAEDSWPSDMCKKMFEVEKVNCICVDWRHGSRAMYTQAVQNIRVVGAETAFLIQALSTQLGYSLEDVHVIGHSLGAHTAAEAGRRLGGRVGRITGLDPAGPCFQDEPEEVRLDPSDAVFVDVIHTDSSPIVPSLGFGMSQKVGHLDFFPNGGKEMPGCKKNVLSTITDIDGIWEGIGGFVSCNHLRSFEYYSSSVLNPDGFLGYPCASYDEFQESKCFPCPAEGCPKMGHYADQFKGKTSAVEQTFFLNTGESGNFTSWRYKVSVTLSGKEKVNGYIRIALYGSNENSKQYEIFKGSLKPDASHTCAIDVDFNVGKIQKVKFLWNKRGINLSEPKLGASQITVQSGEDGTEYNFCSSDTVEENVLQSLYPC
Applicable Applications for anti-PNLIPRP2 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human PNLIPRP2, aa1-469 (AAH05989.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(PNLIPRP2 rabbit polyclonal antibody. Western Blot analysis of PNLIPRP2 expression in human pancreas.)

Western Blot (WB) (PNLIPRP2 rabbit polyclonal antibody. Western Blot analysis of PNLIPRP2 expression in human pancreas.)

Western Blot (WB)

(PNLIPRP2 rabbit polyclonal antibody. Western Blot analysis of PNLIPRP2 expression in mouse intestine.)

Western Blot (WB) (PNLIPRP2 rabbit polyclonal antibody. Western Blot analysis of PNLIPRP2 expression in mouse intestine.)

Western Blot (WB)

(Western Blot analysis of PNLIPRP2 expression in transfected 293T cell line by PNLIPRP2 polyclonal antibody. Lane 1: PNLIPRP2 transfected lysate (51.9kD). Lane 2: Non-transfected lysate)

Western Blot (WB) (Western Blot analysis of PNLIPRP2 expression in transfected 293T cell line by PNLIPRP2 polyclonal antibody. Lane 1: PNLIPRP2 transfected lysate (51.9kD). Lane 2: Non-transfected lysate)
Related Product Information for anti-PNLIPRP2 antibody
Lipase with broad substrate specificity. Can hydrolyze both phospholipids and galactolipids. Acts preferentially on monoglycerides, phospholipids and galactolipids. Contributes to milk fat hydrolysis.
Product Categories/Family for anti-PNLIPRP2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
51,947 Da
NCBI Official Full Name
PNLIPRP2
NCBI Official Synonym Full Names
pancreatic lipase-related protein 2
NCBI Official Symbol
PNLIPRP2
NCBI Official Synonym Symbols
PLRP2
NCBI Protein Information
pancreatic lipase-related protein 2; PL-RP2; galactolipase
UniProt Protein Name
Pancreatic lipase-related protein 2
UniProt Gene Name
PNLIPRP2
UniProt Synonym Gene Names
PLRP2; PL-RP2
UniProt Entry Name
LIPR2_HUMAN

NCBI Description

This gene encodes a lipase that hydrolyzes galactolipids, the main components of plant membrane lipids. An allelic polymorphism in this gene results in both coding and non-coding variants; the reference genome represents the non-coding allele. [provided by RefSeq, Aug 2015]

Uniprot Description

PNLIPRP2: Lipase with broad substrate specificity. Can hydrolyze both phospholipids and galactolipids. Acts preferentially on monoglycerides, phospholipids and galactolipids. Contributes to milk fat hydrolysis. Belongs to the AB hydrolase superfamily. Lipase family.

Protein type: Secreted, signal peptide; Lipid Metabolism - glycerolipid; Lipase; EC 3.1.1.26; Secreted; EC 3.1.1.3

Chromosomal Location of Human Ortholog: 10q25.3

Cellular Component: extracellular space; extracellular region

Molecular Function: triacylglycerol lipase activity; galactolipase activity; acylglycerol lipase activity; calcium ion binding; phospholipase activity

Biological Process: triacylglycerol metabolic process; phospholipid catabolic process; galactolipid catabolic process; lipid digestion

Research Articles on PNLIPRP2

Similar Products

Product Notes

The PNLIPRP2 pnliprp2 (Catalog #AAA6008651) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PNLIPRP2 (Pancreatic Lipase-related Protein 2, PL-RP2, Galactolipase, PLRP2) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's PNLIPRP2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the PNLIPRP2 pnliprp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MLPPWTLGLL LLATVRGKEV CYGQLGCFSD EKPWAGTLQR PVKLLPWSPE DIDTRFLLYT NENPNNFQLI TGTEPDTIEA SNFQLDRKTR FIIHGFLDKA EDSWPSDMCK KMFEVEKVNC ICVDWRHGSR AMYTQAVQNI RVVGAETAFL IQALSTQLGY SLEDVHVIGH SLGAHTAAEA GRRLGGRVGR ITGLDPAGPC FQDEPEEVRL DPSDAVFVDV IHTDSSPIVP SLGFGMSQKV GHLDFFPNGG KEMPGCKKNV LSTITDIDGI WEGIGGFVSC NHLRSFEYYS SSVLNPDGFL GYPCASYDEF QESKCFPCPA EGCPKMGHYA DQFKGKTSAV EQTFFLNTGE SGNFTSWRYK VSVTLSGKEK VNGYIRIALY GSNENSKQYE IFKGSLKPDA SHTCAIDVDF NVGKIQKVKF LWNKRGINLS EPKLGASQIT VQSGEDGTEY NFCSSDTVEE NVLQSLYPC. It is sometimes possible for the material contained within the vial of "PNLIPRP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.