Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PMS1Sample Tissue: Human U937 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human PMS1 Polyclonal Antibody | anti-PMS1 antibody

PMS1 Antibody - middle region

Gene Names
PMS1; MLH2; PMSL1; hPMS1; HNPCC3
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
PMS1; Polyclonal Antibody; PMS1 Antibody - middle region; anti-PMS1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PFQNDMHNDESGKNTDDCLNHQISIGDFGYGHCSSEISNIDKNTKNAFQD
Sequence Length
932
Applicable Applications for anti-PMS1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PMS1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PMS1Sample Tissue: Human U937 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PMS1Sample Tissue: Human U937 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-PMS1 antibody
This is a rabbit polyclonal antibody against PMS1. It was validated on Western Blot

Target Description: This gene encodes a protein belonging to the DNA mismatch repair mutL/hexB family. This protein is thought to be involved in the repair of DNA mismatches, and it can form heterodimers with MLH1, a known DNA mismatch repair protein. Mutations in this gene cause hereditary nonpolyposis colorectal cancer type 3 (HNPCC3) either alone or in combination with mutations in other genes involved in the HNPCC phenotype, which is also known as Lynch syndrome.
Product Categories/Family for anti-PMS1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
102 kDa
NCBI Official Full Name
PMS1 protein homolog 1 isoform a
NCBI Official Synonym Full Names
PMS1 homolog 1, mismatch repair system component
NCBI Official Symbol
PMS1
NCBI Official Synonym Symbols
MLH2; PMSL1; hPMS1; HNPCC3
NCBI Protein Information
PMS1 protein homolog 1
UniProt Protein Name
PMS1 protein homolog 1
Protein Family
UniProt Gene Name
PMS1
UniProt Synonym Gene Names
PMSL1
UniProt Entry Name
PMS1_HUMAN

NCBI Description

This gene encodes a protein belonging to the DNA mismatch repair mutL/hexB family. This protein is thought to be involved in the repair of DNA mismatches, and it can form heterodimers with MLH1, a known DNA mismatch repair protein. Mutations in this gene cause hereditary nonpolyposis colorectal cancer type 3 (HNPCC3) either alone or in combination with mutations in other genes involved in the HNPCC phenotype, which is also known as Lynch syndrome. [provided by RefSeq, Jul 2008]

Uniprot Description

PMS1: Probably involved in the repair of mismatches in DNA. Defects in PMS1 are the cause of hereditary non-polyposis colorectal cancer type 3 (HNPCC3). Mutations in more than one gene locus can be involved alone or in combination in the production of the HNPCC phenotype (also called Lynch syndrome). Most families with clinically recognized HNPCC have mutations in either MLH1 or MSH2 genes. HNPCC is an autosomal, dominantly inherited disease associated with marked increase in cancer susceptibility. It is characterized by a familial predisposition to early onset colorectal carcinoma (CRC) and extra-colonic cancers of the gastrointestinal, urological and female reproductive tracts. HNPCC is reported to be the most common form of inherited colorectal cancer in the Western world, and accounts for 15% of all colon cancers. Cancers in HNPCC originate within benign neoplastic polyps termed adenomas. Clinically, HNPCC is often divided into two subgroups. Type I: hereditary predisposition to colorectal cancer, a young age of onset, and carcinoma observed in the proximal colon. Type II: patients have an increased risk for cancers in certain tissues such as the uterus, ovary, breast, stomach, small intestine, skin, and larynx in addition to the colon. Diagnosis of classical HNPCC is based on the Amsterdam criteria: 3 or more relatives affected by colorectal cancer, one a first degree relative of the other two; 2 or more generation affected; 1 or more colorectal cancers presenting before 50 years of age; exclusion of hereditary polyposis syndromes. The term 'suspected HNPCC' or 'incomplete HNPCC' can be used to describe families who do not or only partially fulfill the Amsterdam criteria, but in whom a genetic basis for colon cancer is strongly suspected. Belongs to the DNA mismatch repair MutL/HexB family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Tumor suppressor; DNA repair, damage

Chromosomal Location of Human Ortholog: 2q31.1

Cellular Component: MutLalpha complex; nucleus

Molecular Function: DNA binding; ATPase activity; ATP binding; single-stranded DNA binding; mismatched DNA binding

Biological Process: response to drug; mismatch repair

Disease: Lynch Syndrome I

Research Articles on PMS1

Similar Products

Product Notes

The PMS1 pms1 (Catalog #AAA3219544) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PMS1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PMS1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PMS1 pms1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PFQNDMHNDE SGKNTDDCLN HQISIGDFGY GHCSSEISNI DKNTKNAFQD. It is sometimes possible for the material contained within the vial of "PMS1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.