Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of PML Protein expression in mouse testis extract (lane 1). PML Protein at 72KD, 97KD was detected using rabbit anti- PML Protein Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Rabbit anti-Mouse PML Polyclonal Antibody | anti-PML antibody

Anti-PML Protein Antibody

Gene Names
Pml; Trim19; AI661194; 1200009E24Rik
Reactivity
Mouse
Applications
Western Blot, Immunohistochemistry
Purity
Immunogen affinity purified.
Synonyms
PML; Polyclonal Antibody; Anti-PML Protein Antibody; MYL; Pml; PP8675; Protein PML; RNF 71; TRIM 19; P29590; promyelocytic leukemia; anti-PML antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
632
Applicable Applications for anti-PML antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes
Western Blot: 0.1-0.5ug/ml
Immunohistochemistry(IHC) Paraffin: 0.5-1ug/ml
Notes
Tested Species: In-house tested species with positive results.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of mouse PML Protein (140-177aa LADFWCFECEQLICSKCFEAHQWYLKHEARPLADLRDN), different from the related human sequence by six amino acids.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of PML Protein expression in mouse testis extract (lane 1). PML Protein at 72KD, 97KD was detected using rabbit anti- PML Protein Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Western Blot (WB) (Western blot analysis of PML Protein expression in mouse testis extract (lane 1). PML Protein at 72KD, 97KD was detected using rabbit anti- PML Protein Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Immunohistochemistry (IHC)

(PML Protein was detected in paraffin-embedded sections of mouse spleen tissues using rabbit anti- PML Protein Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Immunohistochemistry (IHC) (PML Protein was detected in paraffin-embedded sections of mouse spleen tissues using rabbit anti- PML Protein Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )
Related Product Information for anti-PML antibody
Rabbit IgG polyclonal antibody for Protein PML(PML) detection.
Background: The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This phosphoprotein localizes to nuclear bodies where it functions as a transcription factor and tumor suppressor. Its expression is cell-cycle related and it regulates the p53 response to oncogenic signals. The gene is often involved in the translocation with the retinoic acid receptor alpha gene associated with acute promyelocytic leukemia (APL). Extensive alternative splicing of this gene results in several variations of the protein's central and C-terminal regions; all variants encode the same N-terminus. Alternatively spliced transcript variants encoding different isoforms have been identified.
References
1. Dyck, J. A., Maul, G. G., Miller, W. H., Jr., Chen, J. D., Kakizuka, A., Evans, R. M. A novel macromolecular structure is a target of the promyelocyte-retinoic acid receptor oncoprotein. Cell 76: 333-343, 1994.
2. Giorgi, C., Ito, K., Lin, H.-K., Santangelo, C., Wieckowski, M. R., Lebiedzinska, M., Bononi, A., Bonora, M., Duszynski, J., Bernardi, R., Rizzuto, R., Tacchetti, C., Pinton, P., Pandolfi, P. P. PML regulates apoptosis at endoplasmic reticulum by modulating calcium release. Science 330: 1247-1251, 2010.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
93,263 Da
NCBI Official Full Name
protein PML isoform 3
NCBI Official Synonym Full Names
promyelocytic leukemia
NCBI Official Symbol
Pml
NCBI Official Synonym Symbols
Trim19; AI661194; 1200009E24Rik
NCBI Protein Information
protein PML
UniProt Protein Name
Protein PML
Protein Family
UniProt Gene Name
Pml

Uniprot Description

PML: a zinc-finger protein that can regulate transcription and can localize to nuclear bodies. Cytoplasmic forms regulate glycolysis by inhibiting the tetrameric form of PKM2. Together with SATB1, involved in local chromatin-loop remodeling and gene expression regulation at the MHC-I locus. Interacts with SIRT1, TOPBP1, TRIM27 and TRIM69. Sumoylated forms interact with SATB1 and localize to the PML nuclear bodies. Sumoylation on three sites is required for nuclear body formation. Sumoylation on Lys-160 is a prerequisite for sumoylation on Lys-65. The B1 box and the RING finger are also required for localization to nuclear bodies. May play an important role in recruitment of ELF4 into PML nuclear bodies. A chromosomal aberration involving PML can cause acute promyelocytic leukemia (APL). Seven alternatively-spliced human isoforms have been reported.

Protein type: Nucleolus; Oncoprotein; Transcription factor; Tumor suppressor; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 9 B|9 31.63 cM

Cellular Component: cytoplasm; cytosol; nuclear chromosome, telomeric region; nuclear matrix; nuclear membrane; nucleolus; nucleoplasm; nucleus; PML body

Molecular Function: protein binding; protein homodimerization activity; SMAD binding; SUMO binding; transcription coactivator activity; ubiquitin protein ligase binding

Biological Process: caspase activation; cell aging; cell cycle arrest; cell fate commitment; circadian regulation of gene expression; common-partner SMAD protein phosphorylation; DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest; DNA damage response, signal transduction by p53 class mediator resulting in induction of apoptosis; DNA damage response, signal transduction resulting in induction of apoptosis; endoplasmic reticulum calcium ion homeostasis; entrainment of circadian clock by photoperiod; induction of apoptosis by oxidative stress; innate immune response; maintenance of protein localization in nucleus; myeloid cell differentiation; negative regulation of angiogenesis; negative regulation of cell growth; negative regulation of cell proliferation; negative regulation of interleukin-1 beta secretion; negative regulation of interleukin-1 secretion; negative regulation of transcription, DNA-dependent; PML body organization and biogenesis; positive regulation of fibroblast proliferation; positive regulation of MHC class I biosynthetic process; positive regulation of telomere maintenance; positive regulation of transcription from RNA polymerase II promoter; proteasomal ubiquitin-dependent protein catabolic process; protein complex assembly; regulation of cell adhesion; regulation of circadian rhythm; regulation of MHC class I biosynthetic process; regulation of protein amino acid phosphorylation; regulation of transcription, DNA-dependent; response to cytokine stimulus; response to gamma radiation; response to hypoxia; response to UV; retinoic acid receptor signaling pathway; SMAD protein nuclear translocation; transforming growth factor beta receptor signaling pathway

Research Articles on PML

Similar Products

Product Notes

The PML pml (Catalog #AAA178841) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-PML Protein Antibody reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's PML can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC) Paraffin. Western Blot: 0.1-0.5ug/ml Immunohistochemistry(IHC) Paraffin: 0.5-1ug/ml. Researchers should empirically determine the suitability of the PML pml for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PML, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.