Mouse anti-Human PLSCR3 Monoclonal Antibody | anti-PLSCR3 antibody

PLSCR3 (Phospholipid Scramblase 3, PL Scramblase 3, Ca(2+)-dependent Phospholipid Scramblase 3) (PE)

Cat. Num. AAA6159529

• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PLSCR3; Monoclonal Antibody; PLSCR3 (Phospholipid Scramblase 3; PL Scramblase 3; Ca(2+)-dependent Phospholipid Scramblase 3) (PE); anti-PLSCR3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 2C8
• Specificity: Recognizes human PLSCR3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-PLSCR3 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-296 from human PLSCR3 (AAH11735) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MAGYLPPKGYAPSPPPPYPVTPGYPEPALHPGPGQAPVPAQVPAPAPGFALFPSPGPVALGSAAPFLPLPGVPSGLEFLVQIDQILIHQKAERVETFLGWETCNRYELRSGAGQPLGQAAEESNCCARLCCGARRPLRVRLADPGDRELLRLLRPLHCGCSCCPCGLQEMEVQAPPGTTIGHVLQTWHPFLPKFSIQDADRQTVLRVVGPCWTCGCGTDTNFEVKTRDESRSVGRISKQWGGLVREALTDADDFGLQFPLDLDVRVKAVLLGATFLIDYMFFEKRGGAGPSAITS
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (58.56kD).)

Western Blot (WB)

(PLSCR3 monoclonal antibody, Western Blot analysis of PLSCR3 expression in HL-60.)

Western Blot (WB)

(Western Blot analysis of PLSCR3 expression in transfected 293T cell line by PLSCR3 monoclonal antibody. Lane 1: PLSCR3 transfected lysate (31.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB)

(Western blot analysis of PLSCR3 over-expressed 293 cell line, cotransfected with PLSCR3 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PLSCR3 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Related Product Information for anti-PLSCR3 antibody

May mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane. May play a central role in the initiation of fibrin clot formation, in the activation of mast cells and in the recognition of apoptotic and injured cells by the reticuloendothelial system. Seems to play a role in apoptosis, through translocation of cardiolipin from the inner to the outer mitochondrial membrane which promotes BID recruitment and enhances tBid-induced mitochondrial damages.

Product Categories/Family for anti-PLSCR3 antibody

Antibodies; Enzymes

NCBI and Uniprot Product Information

• NCBI GI #: 33877658
• NCBI GeneID: 57048
• Molecular Weight: 31,648 Da
• NCBI Official Full Name: Homo sapiens phospholipid scramblase 3, mRNA
• NCBI Official Synonym Full Names: phospholipid scramblase 3
• NCBI Official Symbol: PLSCR3
• NCBI Protein Information: phospholipid scramblase 3
• Protein Family: Phospholipid scramblase