Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-PLSCR1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: NucleusPrimary Antibody Concentration: N/AOther Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit anti-Human PLSCR1 Polyclonal Antibody | anti-PLSCR1 antibody

PLSCR1 antibody - N-terminal region

Gene Names
PLSCR1; MMTRA1B
Reactivity
Human
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
PLSCR1; Polyclonal Antibody; PLSCR1 antibody - N-terminal region; anti-PLSCR1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MDKQNSQMNASHPETNLPVGYPPQYPPTAFQGPPGYSGYPGPQVSYPPPP
Sequence Length
318
Applicable Applications for anti-PLSCR1 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PLSCR1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-PLSCR1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: NucleusPrimary Antibody Concentration: N/AOther Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC) (Rabbit Anti-PLSCR1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: NucleusPrimary Antibody Concentration: N/AOther Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-PLSCR1 antibody
This is a rabbit polyclonal antibody against PLSCR1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PLSCR1 may mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane.PLSCR1 may play a central role in the initiation of fibrin clot formation, in the activation of mast cells and in the recognition of apoptotic and injured cells by the reticuloendothelial system.
Product Categories/Family for anti-PLSCR1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
phospholipid scramblase 1 isoform 1
NCBI Official Synonym Full Names
phospholipid scramblase 1
NCBI Official Symbol
PLSCR1
NCBI Official Synonym Symbols
MMTRA1B
NCBI Protein Information
phospholipid scramblase 1
UniProt Protein Name
Phospholipid scramblase 1
Protein Family
UniProt Gene Name
PLSCR1
UniProt Synonym Gene Names
PL scramblase 1
UniProt Entry Name
PLS1_HUMAN

Uniprot Description

PLSCR1: May mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane. May play a central role in the initiation of fibrin clot formation, in the activation of mast cells and in the recognition of apoptotic and injured cells by the reticuloendothelial system. Belongs to the phospholipid scramblase family.

Protein type: Calcium-binding; Membrane protein, integral

Chromosomal Location of Human Ortholog: 3q23

Cellular Component: extracellular matrix; Golgi apparatus; membrane; integral to plasma membrane; plasma membrane; nucleolus; cytosol; nucleus; lipid raft

Molecular Function: phospholipid scramblase activity; protein binding; enzyme binding; DNA binding; calcium ion binding; SH3 domain binding; CD4 receptor binding; epidermal growth factor receptor binding

Biological Process: platelet activation; negative regulation of viral genome replication; apoptosis; positive regulation of innate immune response; acute-phase response; positive regulation of transcription from RNA polymerase II promoter; phospholipid scrambling; defense response to virus; regulation of mast cell activation; phosphatidylserine biosynthetic process

Research Articles on PLSCR1

Similar Products

Product Notes

The PLSCR1 plscr1 (Catalog #AAA3213398) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PLSCR1 antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PLSCR1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). Researchers should empirically determine the suitability of the PLSCR1 plscr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MDKQNSQMNA SHPETNLPVG YPPQYPPTAF QGPPGYSGYP GPQVSYPPPP. It is sometimes possible for the material contained within the vial of "PLSCR1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.