Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PLS1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Lung)

Rabbit PLS1 Polyclonal Antibody | anti-PLS1 antibody

PLS1 antibody - N-terminal region

Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat,
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PLS1; Polyclonal Antibody; PLS1 antibody - N-terminal region; anti-PLS1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat,
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ISFEEFVSLMQELKSKDISKTFRKIINKREGITAIGGTSTISSEGTQHSY
Sequence Length
629
Applicable Applications for anti-PLS1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PLS1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PLS1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Lung)

Western Blot (WB) (WB Suggested Anti-PLS1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Lung)
Related Product Information for anti-PLS1 antibody
This is a rabbit polyclonal antibody against PLS1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Plastins are a family of actin-binding proteins that are conserved throughout eukaryote evolution and expressed in most tissues of higher eukaryotes. In humans, two ubiquitous plastin isoforms (L and T) have been identified. The protein encoded by this ge
Product Categories/Family for anti-PLS1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
70kDa
NCBI Official Full Name
plastin-1
NCBI Official Synonym Full Names
plastin 1
NCBI Official Symbol
PLS1
NCBI Protein Information
plastin-1
UniProt Protein Name
Plastin-1
Protein Family
UniProt Gene Name
PLS1
UniProt Synonym Gene Names
I-plastin

NCBI Description

Plastins are a family of actin-binding proteins that are conserved throughout eukaryote evolution and expressed in most tissues of higher eukaryotes. In humans, two ubiquitous plastin isoforms (L and T) have been identified. The protein encoded by this gene is a third distinct plastin isoform, which is specifically expressed at high levels in the small intestine. Alternatively spliced transcript variants varying in the 5' UTR, but encoding the same protein, have been found for this gene. A pseudogene of this gene is found on chromosome 11.[provided by RefSeq, Feb 2010]

Uniprot Description

PLS1: Actin-bundling protein in the absence of calcium.

Protein type: Actin-binding; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 3q23

Cellular Component: actin filament; actin filament bundle; brush border; cytoplasm

Molecular Function: actin filament binding; calcium ion binding; structural constituent of cytoskeleton

Biological Process: actin crosslink formation; actin filament bundle formation; actin filament network formation; D-glucose absorption; positive regulation of multicellular organism growth; regulation of microvillus length

Research Articles on PLS1

Similar Products

Product Notes

The PLS1 pls1 (Catalog #AAA3212747) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PLS1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, and may cross-react with other species as described in the data sheet. AAA Biotech's PLS1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PLS1 pls1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ISFEEFVSLM QELKSKDISK TFRKIINKRE GITAIGGTST ISSEGTQHSY. It is sometimes possible for the material contained within the vial of "PLS1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.