Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: C11orf34Sample Type: HT1080 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human PLET1 Polyclonal Antibody | anti-PLET1 antibody

PLET1 Antibody - middle region

Gene Names
PLET1; C11orf34
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PLET1; Polyclonal Antibody; PLET1 Antibody - middle region; anti-PLET1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NSDSAGLWQRADKNCYSNSTYYVKDQYMTVLEAQWQAPEPENITEVEIQA
Sequence Length
207
Applicable Applications for anti-PLET1 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human C11orf34
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: C11orf34Sample Type: HT1080 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: C11orf34Sample Type: HT1080 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-PLET1 antibody
This is a rabbit polyclonal antibody against C11orf34. It was validated on Western Blot
Product Categories/Family for anti-PLET1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22kDa
NCBI Official Full Name
placenta-expressed transcript 1 protein
NCBI Official Synonym Full Names
placenta expressed transcript 1
NCBI Official Symbol
PLET1
NCBI Official Synonym Symbols
C11orf34
NCBI Protein Information
placenta-expressed transcript 1 protein
UniProt Protein Name
Placenta-expressed transcript 1 protein
UniProt Gene Name
PLET1
UniProt Synonym Gene Names
C11orf34

Uniprot Description

PLET1: May participate in the wound response during the healing process, and promote wound repair.

Protein type: Membrane protein, GPI anchor; Membrane protein, integral

Chromosomal Location of Human Ortholog: 11q23.1

Cellular Component: apical plasma membrane; external side of plasma membrane; extracellular region; plasma membrane

Biological Process: C-terminal protein lipidation; cell differentiation; negative regulation of cell-matrix adhesion; positive regulation of cell migration; wound healing, spreading of epidermal cells

Research Articles on PLET1

Similar Products

Product Notes

The PLET1 plet1 (Catalog #AAA3217471) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PLET1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PLET1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PLET1 plet1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NSDSAGLWQR ADKNCYSNST YYVKDQYMTV LEAQWQAPEP ENITEVEIQA. It is sometimes possible for the material contained within the vial of "PLET1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.