Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CCDC74BSample Type: Fetal Lung lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human VN1R5 Polyclonal Antibody | anti-VN1R5 antibody

VN1R5 Antibody - middle region

Gene Names
VN1R5; V1RL5
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
VN1R5; Polyclonal Antibody; VN1R5 Antibody - middle region; anti-VN1R5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AINSSTRLGSGGTQDDLRYKLIMNQTSQKKDSLSTSSFQSVKSISNSGKA
Sequence Length
204
Applicable Applications for anti-VN1R5 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human VN1R5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CCDC74BSample Type: Fetal Lung lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CCDC74BSample Type: Fetal Lung lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-VN1R5 antibody
This is a rabbit polyclonal antibody against CCDC74B. It was validated on Western Blot
Product Categories/Family for anti-VN1R5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22kDa
NCBI Official Full Name
vomeronasal type-1 receptor 5
NCBI Official Synonym Full Names
vomeronasal 1 receptor 5 (gene/pseudogene)
NCBI Official Symbol
VN1R5
NCBI Official Synonym Symbols
V1RL5
NCBI Protein Information
vomeronasal type-1 receptor 5
UniProt Protein Name
Vomeronasal type-1 receptor 5
UniProt Gene Name
VN1R5
UniProt Synonym Gene Names
V1RL5; hGPCR26
UniProt Entry Name
VN1R5_HUMAN

Uniprot Description

VN1R5: Putative pheromone receptor. Belongs to the G-protein coupled receptor 1 family.

Protein type: Receptor, GPCR; GPCR, family 1; Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 1q44

Cellular Component: plasma membrane; integral to membrane

Molecular Function: pheromone receptor activity

Biological Process: G-protein coupled receptor protein signaling pathway; response to pheromone

Similar Products

Product Notes

The VN1R5 vn1r5 (Catalog #AAA3219025) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The VN1R5 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's VN1R5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the VN1R5 vn1r5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AINSSTRLGS GGTQDDLRYK LIMNQTSQKK DSLSTSSFQS VKSISNSGKA. It is sometimes possible for the material contained within the vial of "VN1R5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.