Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PLEKSample Tissue: Human 721_B Whole CellAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human PLEK Polyclonal Antibody | anti-PLEK antibody

PLEK Antibody - N-terminal region

Gene Names
PLEK; P47
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
PLEK; Polyclonal Antibody; PLEK Antibody - N-terminal region; anti-PLEK antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPLKGSTLTSP
Sequence Length
167
Applicable Applications for anti-PLEK antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PLEK
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PLEKSample Tissue: Human 721_B Whole CellAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PLEKSample Tissue: Human 721_B Whole CellAntibody Dilution: 1.0ug/ml)
Product Categories/Family for anti-PLEK antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40 kDa
NCBI Official Full Name
pleckstrin
NCBI Official Synonym Full Names
pleckstrin
NCBI Official Symbol
PLEK
NCBI Official Synonym Symbols
P47
NCBI Protein Information
pleckstrin
UniProt Protein Name
Pleckstrin
Protein Family
UniProt Gene Name
PLEK
UniProt Synonym Gene Names
P47; p47
UniProt Entry Name
PLEK_HUMAN

Uniprot Description

pleckstrin: Major protein kinase C substrate of platelets.

Protein type: Lipid-binding

Chromosomal Location of Human Ortholog: 2p13.3

Cellular Component: membrane; cytoplasm; extracellular region; cytosol

Molecular Function: protein binding; protein homodimerization activity; protein kinase C binding; phosphatidylinositol-3,4-bisphosphate binding

Biological Process: negative regulation of calcium-mediated signaling; integrin-mediated signaling pathway; platelet activation; phospholipase C inhibition; positive regulation of actin filament depolymerization; negative regulation of G-protein coupled receptor protein signaling pathway; positive regulation of integrin activation; platelet degranulation; cell projection organization and biogenesis; actin cytoskeleton reorganization; ruffle organization and biogenesis; positive regulation of actin filament bundle formation; hemopoietic progenitor cell differentiation; phosphatidylinositol metabolic process; cortical actin cytoskeleton organization and biogenesis; blood coagulation; vesicle docking during exocytosis

Research Articles on PLEK

Similar Products

Product Notes

The PLEK plek (Catalog #AAA3220362) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PLEK Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PLEK can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PLEK plek for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GYLVKKGSVF NTWKPMWVVL LEDGIEFYKK KSDNSPKGMI PLKGSTLTSP. It is sometimes possible for the material contained within the vial of "PLEK, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.