Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PLAGL1Sample Tissue: Human A549 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human PLAGL1 Polyclonal Antibody | anti-PLAGL1 antibody

PLAGL1 Antibody - middle region

Gene Names
PLAGL1; ZAC; LOT1; ZAC1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
PLAGL1; Polyclonal Antibody; PLAGL1 Antibody - middle region; anti-PLAGL1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 29% sucrose.
Sequence
Synthetic peptide located within the following region: LPESLASLHPSVSPGSPPPPLPNHKYNTTSTSYSPLASLPLKADTKGFCN
Sequence Length
411
Applicable Applications for anti-PLAGL1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PLAGL1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PLAGL1Sample Tissue: Human A549 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PLAGL1Sample Tissue: Human A549 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-PLAGL1 antibody
This gene encodes a C2H2 zinc finger protein that functions as a suppressor of cell growth. This gene is often deleted or methylated and silenced in cancer cells. In addition, overexpression of this gene during fetal development is thought to be the causal factor for transient neonatal diabetes mellitus (TNDM). Alternative splicing and the use of alternative promoters results in multiple transcript variants encoding two different protein isoforms. The P1 downstream promoter of this gene is imprinted, with preferential expression from the paternal allele in many tissues.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45 kDa
NCBI Official Full Name
zinc finger protein PLAGL1 isoform 2
NCBI Official Synonym Full Names
PLAG1 like zinc finger 1
NCBI Official Symbol
PLAGL1
NCBI Official Synonym Symbols
ZAC; LOT1; ZAC1
NCBI Protein Information
zinc finger protein PLAGL1
UniProt Protein Name
Zinc finger protein PLAGL1
Protein Family
UniProt Gene Name
PLAGL1
UniProt Synonym Gene Names
LOT1; ZAC; LOT-1
UniProt Entry Name
PLAL1_HUMAN

NCBI Description

This gene encodes a C2H2 zinc finger protein that functions as a suppressor of cell growth. This gene is often deleted or methylated and silenced in cancer cells. In addition, overexpression of this gene during fetal development is thought to be the causal factor for transient neonatal diabetes mellitus (TNDM). Alternative splicing and the use of alternative promoters results in multiple transcript variants encoding two different protein isoforms. The P1 downstream promoter of this gene is imprinted, with preferential expression from the paternal allele in many tissues. [provided by RefSeq, Nov 2015]

Uniprot Description

PLAGL1: Shows weak transcriptional activatory activity. Transcriptional regulator of the type 1 receptor for pituitary adenylate cyclase-activating polypeptide. Belongs to the krueppel C2H2-type zinc-finger protein family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Nuclear receptor co-regulator; C2H2-type zinc finger protein

Chromosomal Location of Human Ortholog: 6q24-q25

Cellular Component: nucleoplasm; Golgi apparatus; intracellular membrane-bound organelle; nucleus

Molecular Function: DNA binding; metal ion binding

Biological Process: transcription from RNA polymerase II promoter; apoptosis; positive regulation of transcription from RNA polymerase II promoter; cell differentiation; cell cycle arrest

Disease: Diabetes Mellitus, Transient Neonatal, 1

Research Articles on PLAGL1

Similar Products

Product Notes

The PLAGL1 plagl1 (Catalog #AAA3219814) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PLAGL1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PLAGL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PLAGL1 plagl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LPESLASLHP SVSPGSPPPP LPNHKYNTTS TSYSPLASLP LKADTKGFCN. It is sometimes possible for the material contained within the vial of "PLAGL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.