Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PLA2R1Sample Tissue: Human 293T Whole CellAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human PLA2R1 Polyclonal Antibody | anti-PLA2R1 antibody

PLA2R1 Antibody - middle region

Gene Names
PLA2R1; PLA2R; PLA2-R; PLA2IR; CLEC13C; PLA2G1R
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
PLA2R1; Polyclonal Antibody; PLA2R1 Antibody - middle region; anti-PLA2R1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DENASETWIGLSSNKIPVSFEWSNDSSVIFTNWHTLEPHIFPNRSQLCVS
Sequence Length
167
Applicable Applications for anti-PLA2R1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PLA2R1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PLA2R1Sample Tissue: Human 293T Whole CellAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PLA2R1Sample Tissue: Human 293T Whole CellAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-PLA2R1 antibody
This gene represents a phospholipase A2 receptor. The encoded protein likely exists as both a transmembrane form and a soluble form. The transmembrane receptor may play a role in clearance of phospholipase A2, thereby inhibiting its action. Polymorphisms at this locus have been associated with susceptibility to idiopathic membranous nephropathy. Alternatively spliced transcript variants encoding different isoforms have been identified.
Product Categories/Family for anti-PLA2R1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
169 kDa
NCBI Official Full Name
secretory phospholipase A2 receptor isoform 2
NCBI Official Synonym Full Names
phospholipase A2 receptor 1
NCBI Official Symbol
PLA2R1
NCBI Official Synonym Symbols
PLA2R; PLA2-R; PLA2IR; CLEC13C; PLA2G1R
NCBI Protein Information
secretory phospholipase A2 receptor
UniProt Protein Name
Secretory phospholipase A2 receptor
UniProt Gene Name
PLA2R1
UniProt Synonym Gene Names
CLEC13C; PLA2-R; PLA2R; Soluble PLA2-R
UniProt Entry Name
PLA2R_HUMAN

NCBI Description

This gene represents a phospholipase A2 receptor. The encoded protein likely exists as both a transmembrane form and a soluble form. The transmembrane receptor may play a role in clearance of phospholipase A2, thereby inhibiting its action. Polymorphisms at this locus have been associated with susceptibility to idiopathic membranous nephropathy. Alternatively spliced transcript variants encoding different isoforms have been identified.[provided by RefSeq, Sep 2010]

Uniprot Description

PLA2R1: Receptor for secretory phospholipase A2 (sPLA2). Acts as a receptor for phosholipase sPLA2-IB/PLA2G1B but not sPLA2- IIA/PLA2G2A. Also able to bind to snake PA2-like toxins. Although its precise function remains unclear, binding of sPLA2 to its receptor participates in both positive and negative regulation of sPLA2 functions as well as clearance of sPLA2. Binding of sPLA2- IB/PLA2G1B induces various effects depending on the cell type, such as activation of the mitogen-activated protein kinase (MAPK) cascade to induce cell proliferation, the production of lipid mediators, selective release of arachidonic acid in bone marrow- derived mast cells. In neutrophils, binding of sPLA2-IB/PLA2G1B can activate p38 MAPK to stimulate elastase release and cell adhesion. May be involved in responses in proinflammatory cytokine productions during endotoxic shock. Also has endocytic properties and rapidly internalizes sPLA2 ligands, which is particularly important for the clearance of extracellular sPLA2s to protect their potent enzymatic activities. The soluble secretory phospholipase A2 receptor form is circulating and acts as a negative regulator of sPLA2 functions by blocking the biological functions of sPLA2-IB/PLA2G1B. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, misc.; Membrane protein, integral

Chromosomal Location of Human Ortholog: 2q23-q24

Cellular Component: cell surface; integral to plasma membrane; plasma membrane; extracellular region; integral to membrane; receptor complex

Molecular Function: phospholipase binding; receptor activity; carbohydrate binding

Biological Process: receptor-mediated endocytosis; cytokine production; endocytosis; positive regulation of DNA damage response, signal transduction by p53 class mediator

Research Articles on PLA2R1

Similar Products

Product Notes

The PLA2R1 pla2r1 (Catalog #AAA3220576) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PLA2R1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PLA2R1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PLA2R1 pla2r1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DENASETWIG LSSNKIPVSF EWSNDSSVIF TNWHTLEPHI FPNRSQLCVS. It is sometimes possible for the material contained within the vial of "PLA2R1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.