Western Blot (WB)
(Anti- PLA2G4A Picoband antibody, MBS178123, Western blottingAll lanes: Anti PLA2G4A (MBS178123) at 0.5ug/mlLane 1: HELA Whole Cell Lysate at 40ugLane 2: NIH3T3 Whole Cell Lysate at 40ugPredicted bind size: 85KDObserved bind size: 85KD )
anti-Human, Mouse PLA2G4A Polyclonal Antibody | anti-PLA2G4A antibody
Anti-PLA2G4A Antibody
Gene Names
PLA2G4A; cPLA2; PLA2G4; cPLA2-alpha
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
PLA2G4A; Polyclonal Antibody; Anti-PLA2G4A Antibody; Cytosolic phospholipase A2; Calcium dependent phospholipid binding protein; CPLA 2; cPLA2 alpha; cPLA2; Cytosolic phospholipase A2 group IVA; Lysophospholipase; MGC126350; PA24A_HUMAN; Phosphatidylcholine 2 acylhydrolase; Phosphatidylcholine 2-acylhydrolase; Phospholipase A2 group 4 A; Phospholipase A2 group IVA (cytosolic calcium dependent); Phospholipase A2 group IVA; PhospholipaseA2; PLA2G4; pla2g4a antibody; phospholipase A2; group IVA (cytosolic; calcium-dependent); anti-PLA2G4A antibody
Reactivity
Human, Mouse
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
689
Applicable Applications for anti-PLA2G4A antibody
Western Blot (WB)
Application Notes
Western Blot Concentration: 0.1-0.5ug/ml
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human PLA2G4A (682-721aa NFQYPNQAFKRLHDLMHFNTLNNIDVIKEAMVESIEYRRQ), different from the related mouse and rat sequences by three amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Western Blot (WB)
(Anti- PLA2G4A Picoband antibody, MBS178123, Western blottingAll lanes: Anti PLA2G4A (MBS178123) at 0.5ug/mlLane 1: HELA Whole Cell Lysate at 40ugLane 2: NIH3T3 Whole Cell Lysate at 40ugPredicted bind size: 85KDObserved bind size: 85KD )
Western Blot (WB)
(Anti- PLA2G4A Picoband antibody, MBS178123, Western blottingAll lanes: Anti PLA2G4A (MBS178123) at 0.5ug/mlLane 1: HELA Whole Cell Lysate at 40ugLane 2: NIH3T3 Whole Cell Lysate at 40ugPredicted bind size: 85KDObserved bind size: 85KD )
Related Product Information for anti-PLA2G4A antibody
Description: Rabbit IgG polyclonal antibody for Cytosolic phospholipase A2(PLA2G4A) detection. Tested with WB in Human;Mouse.
Background: PLA2G4A (Phospholipase A2, Group IVA), is an enzyme that in humans is encoded by the PLA2G4A gene. Tay et al. (1995) mapped the PLA2G4A gene to rat chromosome 13 by PCR-based intercross genotyping and to human 1q25 by fluorescence in situ hybridization. By site-directed mutagenesis and biochemical analysis of the recombinant protein, Sharp et al. (1994) determined that ser228 participates in the catalytic mechanism of cPLA2 and that both the phospholipase A2 and the lysophospholipase activities are catalyzed by the same active site residue(s). PLA2G4A, the cytosolic phospholipase A2, appears to subserve transmembrane signaling responses to extracellular ligands (Skorecki, 1995).
Background: PLA2G4A (Phospholipase A2, Group IVA), is an enzyme that in humans is encoded by the PLA2G4A gene. Tay et al. (1995) mapped the PLA2G4A gene to rat chromosome 13 by PCR-based intercross genotyping and to human 1q25 by fluorescence in situ hybridization. By site-directed mutagenesis and biochemical analysis of the recombinant protein, Sharp et al. (1994) determined that ser228 participates in the catalytic mechanism of cPLA2 and that both the phospholipase A2 and the lysophospholipase activities are catalyzed by the same active site residue(s). PLA2G4A, the cytosolic phospholipase A2, appears to subserve transmembrane signaling responses to extracellular ligands (Skorecki, 1995).
References
1. Sharp, J. D., Pickard, R. T., Chiou, X. G., Manetta, J. V., Kovacevic, S., Miller, J. R., Varshavsky, A. D., Roberts, E. F., Strifler, B. A., Brems, D. N., Kramer, R. M. Serine 228 is essential for catalytic activities of 85-kDa cytosolic phospholipase A2. J. Biol. Chem. 269: 23250-23254, 1994. 2. Skorecki, K. L. Personal Communication. Toronto, Canada 4/19/1995. 3. Tay, A., Simon, J. S., Squire, J., Hamel, K., Jacob, H. J., Skorecki, K. Cytosolic phospholipase A2 gene in human and rat: chromosomal localization and polymorphic markers. Genomics 26: 138-141, 1995.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
85,239 Da
NCBI Official Full Name
cytosolic phospholipase A2 isoform 2
NCBI Official Synonym Full Names
phospholipase A2 group IVA
NCBI Official Symbol
PLA2G4A
NCBI Official Synonym Symbols
cPLA2; PLA2G4; cPLA2-alpha
NCBI Protein Information
cytosolic phospholipase A2
UniProt Protein Name
Cytosolic phospholipase A2
Protein Family
UniProt Gene Name
PLA2G4A
UniProt Synonym Gene Names
CPLA2; PLA2G4; cPLA2
UniProt Entry Name
PA24A_HUMAN
NCBI Description
This gene encodes a member of the cytosolic phospholipase A2 group IV family. The enzyme catalyzes the hydrolysis of membrane phospholipids to release arachidonic acid which is subsequently metabolized into eicosanoids. Eicosanoids, including prostaglandins and leukotrienes, are lipid-based cellular hormones that regulate hemodynamics, inflammatory responses, and other intracellular pathways. The hydrolysis reaction also produces lysophospholipids that are converted into platelet-activating factor. The enzyme is activated by increased intracellular Ca(2+) levels and phosphorylation, resulting in its translocation from the cytosol and nucleus to perinuclear membrane vesicles. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2015]
Uniprot Description
Selectively hydrolyzes arachidonyl phospholipids in the sn-2 position releasing arachidonic acid. Together with its lysophospholipid activity, it is implicated in the initiation of the inflammatory response.
Research Articles on PLA2G4A
Similar Products
Product Notes
The PLA2G4A pla2g4a (Catalog #AAA178123) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-PLA2G4A Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's PLA2G4A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot Concentration: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the PLA2G4A pla2g4a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PLA2G4A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
