anti-Human PKR Polyclonal Antibody | anti-PKR antibody

Anti-PKR Antibody

Cat. Num. AAA178324

• Gene Names: EIF2AK2; PKR; PRKR; EIF2AK1; PPP1R83
• Reactivity: Human
• Applications: Western Blot
• Purity: Immunogen Affinity Purified
• Synonyms: PKR; Polyclonal Antibody; Anti-PKR Antibody; Interferon-induced; double-stranded RNA-activated protein kinase; double stranded RNA activated protein kinase;; E2AK2_HUMAN; eIF-2A protein kinase 2; EIF2AK1; EIF2AK2; Eukaryotic translation initiation factor 2 alpha kinase 2; Eukaryotic translation initiation factor 2-alpha kinase 2; eukaryotic translation initiation factor 2-alpha kinase; HGNC:9437; Interferon induced double stranded RNA activated protein kinase; Interferon inducible elF2 alpha kinase; Interferon inducible RNA dependent protein kinase; Interferon inducible RNA-dependent protein kinase; Interferon-inducible RNA-dependent protein kinase; MGC126524; P1/eIF-2A protein kinase; P1/eIF2A protein kinase; p68 kinase; PRKR; Protein kinase interferon inducible double stranded RNA dependent; Protein kinase RNA activated; Protein kinase RNA-activated; Serine/threonine protein kinase TIK; Serine/threonine-protein kinase TIK; Tyrosine protein kinase EIF2AK2 antibody; eukaryotic translation initiation factor 2-alpha kinase 2; anti-PKR antibody

• Reactivity: Human
• Clonality: Polyclonal
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 551

• Applicable Applications for anti-PKR antibody: Western Blot (WB)
• Application Notes: Western Blot Concentration: 0.1-0.5ug/ml
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human PKR(511-551aa EKTLLQKLLSKKPEDRPNTSEILRTLTVWKKSPEKNERHTC), different from the related mouse sequence by fifteen amino acids, and from the related rat sequence by thirteen amino acids.
• Ig Type: Rabbit IgG
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- PKR Picoband antibody, MBS178324, Western blottingAll lanes: Anti PKR (MBS178324) at 0.5ug/mlLane 1: HELA Whole Cell Lysate at 40ugLane 2: A549 Whole Cell Lysate at 40ugPredicted bind size: 69KDObserved bind size: 69KD )

Related Product Information for anti-PKR antibody

Description: Rabbit IgG polyclonal antibody for Interferon-induced, double-stranded RNA-activated protein kinase(EIF2AK2) detection. Tested with WB in Human.

Background: EIF2AK2 (Eukaryotic Translation Initiation Factor 2-Alpha Kinase 2), also called PKR, is an enzyme that in humans is encoded by the EIF2AK2 gene. Activation of EIF2AK2 allows the kinase to phosphorylate its natural substrate, the alpha subunit of eukaryotic protein synthesis initiation factor-2, leading to the inhibition of protein synthesis. By FISH analysis, Squire et al. (1993) assigned the EIF2AK2 gene to the boundary between chromosome 2p22-p21. Ben-Asouli et al. (2002) showed that human gamma-interferon mRNA uses local activation of PKR in the cell to control its own translation yield. IFNG mRNA was found to activate PKR through a pseudoknot in its 5-prime untranslated region. Taylor et al. (1999) studied the mechanism underlying the resistance of hepatitis C virus (HCV) to interferon. They demonstrated that the HCV envelope protein E2 contains a sequence identical with phosphorylation sites of the interferon-inducible protein kinase PKR and the translation initiation factor EIF2-alpha, a target of PKR. E2 inhibited the kinase activity of PKR and blocked its inhibitory effect on protein synthesis and cell growth.

References

1. Ben-Asouli, Y., Banai, Y., Pel-Or, Y., Shir, A., Kaempfer, R. Human interferon-gamma mRNA autoregulates its translation through a pseudoknot that activates the interferon-inducible protein kinase PKR. Cell 108: 221-232, 2002. 2. Kuhen, K. L., Shen, X., Carlisle, E. R., Richardson, A.L., Weier, H.-U. G., Tanaka, H., Samuel, C. E. Structural organization of the human gene (PKR) encoding an interferon-inducible RNA-dependent protein kinase (PKR) and differences from its mouse homolog. Genomics 36: 197-201, 1996. 3. Squire, J., Meurs, E. F., Chong, K. L., McMillan, N. A. J., Hovanessian, A. G., Williams, B. R. G. Localization of the human interferon-induced, ds-RNA activated p68 kinase gene (PRKR) to chromosome 2p21-p22. Genomics 16: 768-770, 1993. 4. Taylor, D. R., Shi, S. T., Romano, P. R., Barber, G. N., Lal, M. M. C. Inhibition of the interferon-inducible protein kinase PKR by HCV E2 protein. Science 285: 107-110, 1999.

NCBI and Uniprot Product Information

• NCBI GI #: 208431827
• NCBI GeneID: 5610
• NCBI Accession #: NP_001129123.1
• NCBI GenBank Nucleotide #: NM_001135651.2
• UniProt Accession #: P19525; Q52M43; Q7Z6F6; Q9UIR4; A8K3P0; D6W584; E9PC80
• Molecular Weight: 57,391 Da
• NCBI Official Full Name: interferon-induced, double-stranded RNA-activated protein kinase isoform a
• NCBI Official Synonym Full Names: eukaryotic translation initiation factor 2 alpha kinase 2
• NCBI Official Symbol: EIF2AK2
• NCBI Official Synonym Symbols: PKR; PRKR; EIF2AK1; PPP1R83
• NCBI Protein Information: interferon-induced, double-stranded RNA-activated protein kinase
• UniProt Protein Name: Interferon-induced, double-stranded RNA-activated protein kinase
• UniProt Gene Name: EIF2AK2
• UniProt Synonym Gene Names: PKR; PRKR; eIF-2A protein kinase 2; PKR; Protein kinase R
• UniProt Entry Name: E2AK2_HUMAN

NCBI Description

The protein encoded by this gene is a serine/threonine protein kinase that is activated by autophosphorylation after binding to dsRNA. The activated form of the encoded protein can phosphorylate translation initiation factor EIF2S1, which in turn inhibits protein synthesis. This protein is also activated by manganese ions and heparin. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]

Uniprot Description

PKR: a protein kinase of the PEK family. Upon binding double-stranded RNA, it becomes autophosphorylated and activated. Phosphorylates and inhibits the alpha subunit of eIF2 alpha, which leads to an inhibition of the initiation of protein synthesis. Controls the activation of several transcription factors such as NF-kappaB, p53 and Stats. Mediates apoptosis induced by many different stimuli, such as LPS, TNF-alpha, viral infection and serum starvation.

Protein type: Kinase, protein; Translation; Protein kinase, Other; Protein kinase, Ser/Thr (non-receptor); EC 2.7.11.1; EC 2.7.10.2; Other group; PEK family

Chromosomal Location of Human Ortholog: 2p22-p21

Cellular Component: cytoplasm; cytosol; membrane; nucleus; perinuclear region of cytoplasm; ribosome

Molecular Function: ATP binding; double-stranded RNA binding; eukaryotic translation initiation factor 2alpha kinase activity; non-membrane spanning protein tyrosine kinase activity; protein binding; protein kinase activity; protein phosphatase type 2A regulator activity; protein serine/threonine kinase activity

Biological Process: activation of MAPKK activity; activation of NF-kappaB transcription factor; cellular response to amino acid starvation; defense response to virus; evasion by virus of host immune response; innate immune response; negative regulation of apoptosis; negative regulation of cell proliferation; negative regulation of osteoblast proliferation; negative regulation of translation; negative regulation of viral genome replication; peptidyl-tyrosine phosphorylation; positive regulation of apoptosis; positive regulation of chemokine production; positive regulation of cytokine production; positive regulation of stress-activated MAPK cascade; protein amino acid autophosphorylation; protein amino acid phosphorylation; regulation of protein phosphatase type 2A activity; response to exogenous dsRNA; response to lipopolysaccharide; response to mechanical stimulus; response to toxin; response to virus; response to vitamin E; transcription, DNA-dependent; translation; unfolded protein response