Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using PKC mu antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 90s.)

Rabbit anti-Human, Mouse PKC mu Polyclonal Antibody | anti-PKCmu antibody

PKC mu Rabbit pAb

Gene Names
PRKD1; PKD; PKCM; PRKCM; PKC-MU
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity purification
Synonyms
PKC mu; Polyclonal Antibody; PKC mu Rabbit pAb; CHDED; PKC-MU; PKCM; PKD; PRKCM; PRKD1; anti-PKCmu antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
YPPNPWKEISHEAIDLINNLLQVKMRKRYSVDKTLSHPWLQDYQTWLDLRELECKIGERYITHESDDLRWEKYAGEQGLQYPTHLINPSASHSDTPETEET
Applicable Applications for anti-PKCmu antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 800-900 of human PKC mu (NP_002733.2).
Cellular Location
Cell membrane, Cytoplasm, Golgi apparatus, trans-Golgi network
Positive Samples
SKOV3, A-549
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using PKC mu antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 90s.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using PKC mu antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 90s.)
Related Product Information for anti-PKCmu antibody
Background: The protein encoded by this gene is a serine/threonine protein kinase involved in many cellular processes, including Golgi body membrane integrity and transport, cell migration and differentiation, MAPK8/JNK1 and Ras pathway signaling, MAPK1/3 (ERK1/2) pathway signaling, cell survival, and regulation of cell shape and adhesion.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
101,704 Da
NCBI Official Full Name
serine/threonine-protein kinase D1
NCBI Official Synonym Full Names
protein kinase D1
NCBI Official Symbol
PRKD1
NCBI Official Synonym Symbols
PKD; PKCM; PRKCM; PKC-MU
NCBI Protein Information
serine/threonine-protein kinase D1; nPKC-D1; nPKC-mu; protein kinase C, mu; protein kinase C mu type
UniProt Protein Name
Serine/threonine-protein kinase D1
UniProt Gene Name
PRKD1
UniProt Synonym Gene Names
PKD; PKD1; PRKCM
UniProt Entry Name
KPCD1_HUMAN

NCBI Description

PRKD1 is a serine/threonine kinase that regulates a variety of cellular functions, including membrane receptor signaling, transport at the Golgi, protection from oxidative stress at the mitochondria, gene transcription, and regulation of cell shape, motility, and adhesion (summary by Eiseler et al., 2009 [PubMed 19329994]).[supplied by OMIM, Nov 2010]

Uniprot Description

PRKD1: a CAMK kinase of the PKD family. Cleavage by caspase-3 following DNA damage activates it and alters its subcellular localization. Sensitizes cells to apoptosis induced by genotoxic stress. Its cleavage is blocked in cells that over-express the anti-apoptotic Bcl-x(L) protein. Expression of a caspase-resistant mutant partially inhibits DNA damage-induced apoptosis. Its activation by TLR ligands is dependent on MyD88, IRAK4 and -1, but not TRAF6. Essential for MyD88-dependent proinflammatory immune responses. Activated by diacylglycerol and phorbol esters. Binds to the trans-Golgi network and regulates the fission of transport carriers specifically destined to the cell surface. Colocalizes with F-actin at peripheral F-actin-rich structures in membrane ruffles at the edge of lamellipodia in cervical carcinoma cells. Substrates reportedly include critical regulatory proteins including CREB, SSH1L, CTNNB1, HDACs 5 and 7, PKD1, HPK1, MARK2, PIP5K2A, PPP1R14A

Protein type: Kinase, protein; Autophagy; Protein kinase, CAMK; Protein kinase, Ser/Thr (non-receptor); Motility/polarity/chemotaxis; EC 2.7.11.13; CAMK group; PKD family

Chromosomal Location of Human Ortholog: 14q11

Cellular Component: integral to plasma membrane; cytoplasm; plasma membrane; intercellular junction; trans-Golgi network; cell cortex; nucleus; cytosol

Molecular Function: identical protein binding; protein serine/threonine kinase activity; protein binding; protein kinase C activity; metal ion binding; ATP binding

Biological Process: integrin-mediated signaling pathway; sphingolipid metabolic process; positive regulation of I-kappaB kinase/NF-kappaB cascade; sphingolipid biosynthetic process; apoptosis; protein amino acid autophosphorylation; negative regulation of endocytosis; positive regulation of blood vessel endothelial cell migration; activation of CREB transcription factor; signal transduction; positive regulation of peptidyl-serine phosphorylation; activation of NF-kappaB transcription factor; Golgi vesicle transport; cell proliferation; positive regulation of osteoblast differentiation; peptidyl-serine phosphorylation; positive regulation of angiogenesis; innate immune response; positive regulation of transcription from RNA polymerase II promoter; positive regulation of endothelial cell proliferation; angiogenesis; vascular endothelial growth factor receptor signaling pathway; inflammatory response; Golgi organization and biogenesis

Research Articles on PKCmu

Similar Products

Product Notes

The PKCmu prkd1 (Catalog #AAA9142203) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PKC mu Rabbit pAb reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's PKC mu can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the PKCmu prkd1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: YPPNPWKEIS HEAIDLINNL LQVKMRKRYS VDKTLSHPWL QDYQTWLDLR ELECKIGERY ITHESDDLRW EKYAGEQGLQ YPTHLINPSA SHSDTPETEE T. It is sometimes possible for the material contained within the vial of "PKC mu, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.