Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PIK3R1Sample Tissue: Human COLO205 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human PIK3R1 Polyclonal Antibody | anti-PIK3R1 antibody

PIK3R1 Antibody - C-terminal region

Gene Names
PIK3R1; p85; AGM7; GRB1; IMD36; p85-ALPHA
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
PIK3R1; Polyclonal Antibody; PIK3R1 Antibody - C-terminal region; anti-PIK3R1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QKGVRQKKLNEWLGNENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAE
Sequence Length
361
Applicable Applications for anti-PIK3R1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human PIK3R1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PIK3R1Sample Tissue: Human COLO205 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PIK3R1Sample Tissue: Human COLO205 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-PIK3R1 antibody
Phosphatidylinositol 3-kinase phosphorylates the inositol ring of phosphatidylinositol at the 3-prime position. The enzyme comprises a 110 kD catalytic subunit and a regulatory subunit of either 85, 55, or 50 kD. This gene encodes the 85 kD regulatory subunit. Phosphatidylinositol 3-kinase plays an important role in the metabolic actions of insulin, and a mutation in this gene has been associated with insulin resistance. Alternative splicing of this gene results in four transcript variants encoding different isoforms.
Product Categories/Family for anti-PIK3R1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39 kDa
NCBI Official Full Name
phosphatidylinositol 3-kinase regulatory subunit alpha isoform 4
NCBI Official Synonym Full Names
phosphoinositide-3-kinase regulatory subunit 1
NCBI Official Symbol
PIK3R1
NCBI Official Synonym Symbols
p85; AGM7; GRB1; IMD36; p85-ALPHA
NCBI Protein Information
phosphatidylinositol 3-kinase regulatory subunit alpha
UniProt Protein Name
Phosphatidylinositol 3-kinase regulatory subunit alpha
UniProt Gene Name
PIK3R1
UniProt Synonym Gene Names
GRB1; PI3-kinase regulatory subunit alpha; PI3K regulatory subunit alpha; PtdIns-3-kinase regulatory subunit alpha; PI3-kinase subunit p85-alpha
UniProt Entry Name
P85A_HUMAN

NCBI Description

Phosphatidylinositol 3-kinase phosphorylates the inositol ring of phosphatidylinositol at the 3-prime position. The enzyme comprises a 110 kD catalytic subunit and a regulatory subunit of either 85, 55, or 50 kD. This gene encodes the 85 kD regulatory subunit. Phosphatidylinositol 3-kinase plays an important role in the metabolic actions of insulin, and a mutation in this gene has been associated with insulin resistance. Alternative splicing of this gene results in four transcript variants encoding different isoforms. [provided by RefSeq, Jun 2011]

Uniprot Description

PIK3R1: regulatory subunit of phosphoinositide-3-kinase. Mediates binding to a subset of tyrosine-phosphorylated proteins through its SH2 domain. Acts as an adapter, mediating the association of the p110 catalytic unit of the alpha, beta and delta enzymes to the plasma membrane, where p110 phosphorylates inositol lipids. May play an additional role in the regulation of the actin cytoskeleton. Necessary for the insulin-stimulated increase in glucose uptake and glycogen synthesis in insulin-sensitive tissues. Its SH2 domains interacts with the YTHM motif of phosphorylated INSR in vitro. Defects in PIK3R1 are a cause of severe insulin resistance. Four alternatively spliced isoforms have been described.

Protein type: Enzyme, regulatory subunit; Kinase, lipid; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 5q13.1

Cellular Component: membrane; cytoplasm; plasma membrane; intercellular junction; phosphoinositide 3-kinase complex; nucleus; cytosol

Molecular Function: insulin binding; insulin-like growth factor receptor binding; protein binding; ErbB-3 class receptor binding; neurotrophin TRKA receptor binding; insulin receptor substrate binding; phosphoinositide 3-kinase binding; phosphoinositide 3-kinase regulator activity; transmembrane receptor protein tyrosine kinase adaptor protein activity; transcription factor binding; protein phosphatase binding; insulin receptor binding

Biological Process: negative regulation of osteoclast differentiation; phosphoinositide 3-kinase cascade; viral reproduction; nerve growth factor receptor signaling pathway; protein amino acid phosphorylation; T cell receptor signaling pathway; positive regulation of RNA splicing; regulation of phosphoinositide 3-kinase activity; NFAT protein import into nucleus; positive regulation of glucose import; phosphoinositide phosphorylation; phospholipid metabolic process; positive regulation of transcription factor import into nucleus; epidermal growth factor receptor signaling pathway; platelet activation; fibroblast growth factor receptor signaling pathway; phosphoinositide-mediated signaling; protein stabilization; negative regulation of cell-matrix adhesion; positive regulation of tumor necrosis factor production; DNA damage response, signal transduction resulting in induction of apoptosis; insulin-like growth factor receptor signaling pathway; induction of apoptosis via death domain receptors; cellular response to insulin stimulus; B cell differentiation; T cell costimulation; insulin receptor signaling pathway; phosphatidylinositol biosynthetic process; innate immune response; cell glucose homeostasis; positive regulation of transcription from RNA polymerase II promoter; vascular endothelial growth factor receptor signaling pathway; blood coagulation; leukocyte migration; positive regulation of cell migration; negative regulation of apoptosis

Disease: Agammaglobulinemia 7, Autosomal Recessive; Short Syndrome; Immunodeficiency 36

Research Articles on PIK3R1

Similar Products

Product Notes

The PIK3R1 pik3r1 (Catalog #AAA3223060) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PIK3R1 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PIK3R1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PIK3R1 pik3r1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QKGVRQKKLN EWLGNENTED QYSLVEDDED LPHHDEKTWN VGSSNRNKAE. It is sometimes possible for the material contained within the vial of "PIK3R1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.