Western Blot (WB)
(WB Suggested Anti-PIGZ Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Hela cell lysate)
Rabbit PIGZ Polyclonal Antibody | anti-PIGZ antibody
PIGZ antibody - N-terminal region
Gene Names
PIGZ; SMP3; PIG-Z; GPI-MT-IV
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PIGZ; Polyclonal Antibody; PIGZ antibody - N-terminal region; anti-PIGZ antibody
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VLWGGLSLLRVLWCLLPQTGYVHPDEFFQSPEVMAEDILGVQAARPWEFY
Sequence Length
579
Applicable Applications for anti-PIGZ antibody
Western Blot (WB)
Homology
Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Yeast: 80%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PIGZ
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-PIGZ Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Hela cell lysate)
Western Blot (WB)
(WB Suggested Anti-PIGZ Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Hela cell lysate)
Related Product Information for anti-PIGZ antibody
This is a rabbit polyclonal antibody against PIGZ. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: The glycosylphosphatidylinositol (GPI) anchor is a glycolipid found on many blood cells that serves to anchor proteins to the cell surface. PIGZ is a protein that is localized to the endoplasmic reticulum, and is involved in GPI anchor biosynthesis. As shown for the yeast homolog, which is a member of a family of dolichol-phosphate-mannose (Dol-P-Man)-dependent mannosyltransferases, this protein can also add a side-branching fourth mannose to GPI precursors during the assembly of GPI anchors.The glycosylphosphatidylinositol (GPI) anchor is a glycolipid found on many blood cells that serves to anchor proteins to the cell surface. This gene encodes a protein that is localized to the endoplasmic reticulum, and is involved in GPI anchor biosynthesis. As shown for the yeast homolog, which is a member of a family of dolichol-phosphate-mannose (Dol-P-Man)-dependent mannosyltransferases, this protein can also add a side-branching fourth mannose to GPI precursors during the assembly of GPI anchors.
Target Description: The glycosylphosphatidylinositol (GPI) anchor is a glycolipid found on many blood cells that serves to anchor proteins to the cell surface. PIGZ is a protein that is localized to the endoplasmic reticulum, and is involved in GPI anchor biosynthesis. As shown for the yeast homolog, which is a member of a family of dolichol-phosphate-mannose (Dol-P-Man)-dependent mannosyltransferases, this protein can also add a side-branching fourth mannose to GPI precursors during the assembly of GPI anchors.The glycosylphosphatidylinositol (GPI) anchor is a glycolipid found on many blood cells that serves to anchor proteins to the cell surface. This gene encodes a protein that is localized to the endoplasmic reticulum, and is involved in GPI anchor biosynthesis. As shown for the yeast homolog, which is a member of a family of dolichol-phosphate-mannose (Dol-P-Man)-dependent mannosyltransferases, this protein can also add a side-branching fourth mannose to GPI precursors during the assembly of GPI anchors.
Product Categories/Family for anti-PIGZ antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
63kDa
NCBI Official Full Name
GPI mannosyltransferase 4
NCBI Official Synonym Full Names
phosphatidylinositol glycan anchor biosynthesis class Z
NCBI Official Symbol
PIGZ
NCBI Official Synonym Symbols
SMP3; PIG-Z; GPI-MT-IV
NCBI Protein Information
GPI mannosyltransferase 4
UniProt Protein Name
GPI mannosyltransferase 4
UniProt Gene Name
PIGZ
UniProt Synonym Gene Names
SMP3; GPI-MT-IV; PIG-Z; hSMP3
UniProt Entry Name
PIGZ_HUMAN
NCBI Description
The glycosylphosphatidylinositol (GPI) anchor is a glycolipid found on many blood cells that serves to anchor proteins to the cell surface. This gene encodes a protein that is localized to the endoplasmic reticulum, and is involved in GPI anchor biosynthesis. As shown for the yeast homolog, which is a member of a family of dolichol-phosphate-mannose (Dol-P-Man)-dependent mannosyltransferases, this protein can also add a side-branching fourth mannose to GPI precursors during the assembly of GPI anchors. [provided by RefSeq, Jul 2008]
Research Articles on PIGZ
Similar Products
Product Notes
The PIGZ pigz (Catalog #AAA3205602) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PIGZ antibody - N-terminal region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's PIGZ can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PIGZ pigz for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VLWGGLSLLR VLWCLLPQTG YVHPDEFFQS PEVMAEDILG VQAARPWEFY. It is sometimes possible for the material contained within the vial of "PIGZ, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
