<
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using PIGM antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 120s.)
Rabbit PIGM Polyclonal Antibody | anti-PIGM antibody
PIGM Rabbit pAb
Gene Names
PIGM; GPI-MT-I
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry, Immunofluorescence
Purity
Affinity purification
Synonyms
PIGM; Polyclonal Antibody; PIGM Rabbit pAb; GPI-MT-I; anti-PIGM antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
YGVFQDRTLHVRYTDIDYQVFTDAARFVTEGRSPYLRATYRYTPLLGWLLTPNIYLSELFGK
Applicable Applications for anti-PIGM antibody
Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
Application Notes
WB: 1:500-1:2000
IHC: 1:50-1:200
IF: 1:50-1:200
IHC: 1:50-1:200
IF: 1:50-1:200
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 35-96 of human PIGM (NP_660150.1).
Positive Samples
BxPC-3, Mouse thymus, Mouse spleen, Mouse lung, Rat thymus, Rat spleen
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using PIGM antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 120s.)
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using PIGM antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 120s.)
Immunohistochemistry (IHC)
(Immunohistochemistry of paraffin-embedded Rat kidney using PIGM Rabbit pAb at dilution of 1:100 (40x lens).)
Immunohistochemistry (IHC)
(Immunohistochemistry of paraffin-embedded Rat kidney using PIGM Rabbit pAb at dilution of 1:100 (40x lens).)
Immunohistochemistry (IHC)
(Immunohistochemistry of paraffin-embedded Mouse kidney using PIGM Rabbit pAb at dilution of 1:100 (40x lens).)
Immunohistochemistry (IHC)
(Immunohistochemistry of paraffin-embedded Mouse kidney using PIGM Rabbit pAb at dilution of 1:100 (40x lens).)
Immunofluorescence (IF)
(Immunofluorescence analysis of L929 cells using PIGM antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)
Immunofluorescence (IF)
(Immunofluorescence analysis of L929 cells using PIGM antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)
Related Product Information for anti-PIGM antibody
Background: This gene encodes a transmembrane protein that is located in the endoplasmic reticulum and is involved in GPI-anchor biosynthesis. The glycosylphosphatidylinositol (GPI)-anchor is a glycolipid which contains three mannose molecules in its core backbone. The GPI-anchor is found on many blood cells and serves to anchor proteins to the cell surface. This gene encodes a mannosyltransferase, GPI-MT-I, that transfers the first mannose to GPI on the lumenal side of the endoplasmic reticulum. [provided by RefSeq, Jul 2008]
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49,460 Da
NCBI Official Full Name
GPI mannosyltransferase 1
NCBI Official Synonym Full Names
phosphatidylinositol glycan anchor biosynthesis, class M
NCBI Official Symbol
PIGM
NCBI Official Synonym Symbols
GPI-MT-I
NCBI Protein Information
GPI mannosyltransferase 1; GPI mannosyltransferase I; PIG-M mannosyltransferase; DPM:GlcN-(acyl-)PI mannosyltransferase; dol-P-Man dependent GPI mannosyltransferase; phosphatidylinositol-glycan biosynthesis class M protein
UniProt Protein Name
GPI mannosyltransferase 1
Protein Family
UniProt Gene Name
PIGM
UniProt Synonym Gene Names
GPI-MT-I; PIG-M
UniProt Entry Name
PIGM_HUMAN
Similar Products
Product Notes
The PIGM pigm (Catalog #AAA9143035) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PIGM Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PIGM can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF). WB: 1:500-1:2000 IHC: 1:50-1:200 IF: 1:50-1:200. Researchers should empirically determine the suitability of the PIGM pigm for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: YGVFQDRTLH VRYTDIDYQV FTDAARFVTE GRSPYLRATY RYTPLLGWLL TPNIYLSELF GK. It is sometimes possible for the material contained within the vial of "PIGM, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
