Rabbit anti-Human PIAS2 Polyclonal Antibody | anti-PIAS2 antibody

PIAS2 (E3 SUMO-protein Ligase PIAS2, Androgen Receptor-interacting Protein 3, ARIP3, DAB2-interacting Protein, DIP, Msx-interacting Zinc Finger Protein, Miz1, PIAS-NY Protein, Protein Inhibitor of Activated STAT x, Protein Inhibitor of Activated STAT2, PI

Cat. Num. AAA6389407

• Gene Names: PIAS2; DIP; MIZ; MIZ1; SIZ2; ARIP3; PIASX; ZMIZ4; PIASX-BETA; PIASX-ALPHA
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PIAS2; Polyclonal Antibody; PIAS2 (E3 SUMO-protein Ligase PIAS2; Androgen Receptor-interacting Protein 3; ARIP3; DAB2-interacting Protein; DIP; Msx-interacting Zinc Finger Protein; Miz1; PIAS-NY Protein; Protein Inhibitor of Activated STAT x; Protein Inhibitor of Activated STAT2; PI; anti-PIAS2 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human PIAS2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-PIAS2 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human PIAS2, aa1-572 (NP_775298.1).
• Immunogen Sequence: MADFEELRNMVSSFRVSELQVLLGFAGRNKSGRKHDLLMRALHLLKSGCSPAVQIKIRELYRRRYPRTLEGLSDLSTIKSSVFSLDGGSSPVEPDLAVAGIHSLPSTSVTPHSPSSPVGSVLLQDTKPTFEMQQPSPPIPPVHPDVQLKNLPFYDVLDVLIKPTSLVQSSIQRFQEKFFIFALTPQQVREICISRDFLPGGRRDYTVQVQLRLCLAETSCPQEDNYPNSLCIKVNGKLFPLPGYAPPPKNGIEQKRPGRPLNITSLVRLSSAVPNQISISWASEIGKNYSMSVYLVRQLTSAMLLQRLKMKGIRNPDHSRALIKEKLTADPDSEIATTSLRVSLMCPLGKMRLTIPCRAVTCTHLQCFDAALYLQMNEKKPTWICPVCDKKAAYESLILDGLFMEILNDCSDVDEIKFQEDGSWCPMRPKKEAMKVSSQPCTKIESSSVLSKPCSVTVASEASKKKVDVIDLTIESSSDEEEDPPAKRKCIFMSETQSSPTKGVLMYQPSSVRVPSVTSVDPAAIPPSLTDYSVPFHHTPISSMSSDLPGEQRRNDINNELKLGTSSDTVQQ
• Conjugate: Biotin
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(PIAS2 rabbit polyclonal antibody. Western Blot analysis of PIAS2 expression in human pancreas.)

Western Blot (WB)

(Western Blot analysis of PIAS2 expression in transfected 293T cell line by PIAS2 polyclonal antibody. Lane 1: PIAS2 transfected lysate (63.4kD). Lane 2: Non-transfected lysate.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between PIAS2 and CDKN2B. HeLa cells were stained with PIAS2 rabbit purified polyclonal 1:1200 and CDKN2B mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Related Product Information for anti-PIAS2 antibody

This gene encodes a protein involved in the regulation of transcription factors involved in MAP kinase signaling. The symbol MIZ1 has also been associated with ZBTB17 which is a different gene located on chromosome 1. Two alternatively spliced transcripts encoding different isoforms have been described. [provided by RefSeq].

Product Categories/Family for anti-PIAS2 antibody

Antibodies; Transcription Factors; STAT

NCBI and Uniprot Product Information

• NCBI GI #: 27532984
• NCBI GeneID: 9063
• NCBI Accession #: NP_775298.1; NP_004662.2
• NCBI GenBank Nucleotide #: NM_173206.2
• Molecular Weight: 45,057 Da
• NCBI Official Full Name: E3 SUMO-protein ligase PIAS2 isoform alpha
• NCBI Official Synonym Full Names: protein inhibitor of activated STAT 2
• NCBI Official Symbol: PIAS2
• NCBI Official Synonym Symbols: DIP; MIZ; MIZ1; SIZ2; ARIP3; PIASX; ZMIZ4; PIASX-BETA; PIASX-ALPHA
• NCBI Protein Information: E3 SUMO-protein ligase PIAS2
• Protein Family: E3 SUMO-protein ligase

NCBI Description

This gene encodes a member of the protein inhibitor of activated STAT (PIAS) family. PIAS proteins function as SUMO E3 ligases and play important roles in many cellular processes by mediating the sumoylation of target proteins. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. Isoforms of the encoded protein enhance the sumoylation of specific target proteins including the p53 tumor suppressor protein, c-Jun, and the androgen receptor. A pseudogene of this gene is located on the short arm of chromosome 4. The symbol MIZ1 has also been associated with ZBTB17 which is a different gene located on chromosome 1. [provided by RefSeq, Aug 2011]