Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PIAS1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Placenta)

Rabbit PIAS1 Polyclonal Antibody | anti-PIAS1 antibody

PIAS1 antibody - N-terminal region

Gene Names
PIAS1; GBP; ZMIZ3; DDXBP1; GU/RH-II
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PIAS1; Polyclonal Antibody; PIAS1 antibody - N-terminal region; anti-PIAS1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MADSAELKQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCS
Sequence Length
651
Applicable Applications for anti-PIAS1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PIAS1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PIAS1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Placenta)

Western Blot (WB) (WB Suggested Anti-PIAS1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Placenta)
Related Product Information for anti-PIAS1 antibody
This is a rabbit polyclonal antibody against PIAS1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PIAS1 is a member of the mammalian PIAS [protein inhibitor of activated STAT-1 (signal transducer and activator of transcription-1)] family. This member contains a putative zinc-binding motif and a highly acidic region. It inhibits STAT1-mediated gene activation and the DNA binding activity, binds to Gu protein/RNA helicase II/DEAD box polypeptide 21, and interacts with androgen receptor (AR). It functions in testis as a nuclear receptor transcriptional coregulator and may have a role in AR initiation and maintenance of spermatogenesis.This gene encodes a member of the mammalian PIAS [protein inhibitor of activated STAT-1 (signal transducer and activator of transcription-1)] family. This member contains a putative zinc-binding motif and a highly acidic region. It inhibits STAT1-mediated gene activation and the DNA binding activity, binds to Gu protein/RNA helicase II/DEAD box polypeptide 21, and interacts with androgen receptor (AR). It functions in testis as a nuclear receptor transcriptional coregulator and may have a role in AR initiation and maintenance of spermatogenesis. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
72kDa
NCBI Official Full Name
E3 SUMO-protein ligase PIAS1 isoform 2
NCBI Official Synonym Full Names
protein inhibitor of activated STAT 1
NCBI Official Symbol
PIAS1
NCBI Official Synonym Symbols
GBP; ZMIZ3; DDXBP1; GU/RH-II
NCBI Protein Information
E3 SUMO-protein ligase PIAS1
UniProt Protein Name
E3 SUMO-protein ligase PIAS1
Protein Family
UniProt Gene Name
PIAS1
UniProt Synonym Gene Names
DDXBP1; GBP
UniProt Entry Name
PIAS1_HUMAN

NCBI Description

This gene encodes a member of the protein inhibitor of activated STAT (PIAS) family. PIAS proteins function as SUMO E3 ligases and play important roles in many cellular processes by mediating the sumoylation of target proteins. This protein plays a central role as a transcriptional coregulator of numerous cellular pathways includign the STAT1 and nuclear factor kappaB pathways. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Mar 2016]

Uniprot Description

PIAS1: Functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizing the interaction between UBE2I and the substrate, and as a SUMO-tethering factor. Plays a crucial role as a transcriptional coregulation in various cellular pathways, including the STAT pathway, the p53 pathway and the steroid hormone signaling pathway. In vitro, binds A/T-rich DNA. The effects of this transcriptional coregulation, transactivation or silencing, may vary depending upon the biological context. Together with PRMT1, may repress STAT1 transcriptional activity, in the late phase of interferon gamma (IFN-gamma) signaling. Interacts with NCOA2 and AR. Interacts with NR2C1; the interaction promotes its sumoylation. Interacts with DDX21, CSRP2, AXIN1, JUN, UBE2I, SUMO1, SATB2, PLAG1, TP53 and STAT1 (dimer), following IFNA1-stimulation. Interacts with SP3 (preferentially when SUMO-modified). Interacts with KLF8; the interaction results in SUMO ligation and repression of KLF8 transcriptional activity and of its cell cycle progression into G(1) phase. Interacts with STAT1. Interacts with CHUK/IKKA; this interaction induces PIAS1 phosphorylation. Interacts with PTK2/FAK1; the interaction promotes its sumoylation. Interacts with DDX5. Expressed in numerous tissues with highest level in testis. Belongs to the PIAS family.

Protein type: SUMO conjugating system; Transcription, coactivator/corepressor; Nuclear receptor co-regulator; EC 6.3.2.-

Chromosomal Location of Human Ortholog: 15q

Cellular Component: nucleoplasm; PML body; nuclear speck; nucleus

Molecular Function: protein domain specific binding; protein binding; enzyme binding; DNA binding; androgen receptor binding; zinc ion binding; ubiquitin protein ligase binding; transcription coactivator activity; transcription corepressor activity; ligase activity

Biological Process: positive regulation of protein sumoylation; protein sumoylation; transcription, DNA-dependent; positive regulation of smooth muscle cell differentiation; positive regulation of proteasomal ubiquitin-dependent protein catabolic process; cytokine and chemokine mediated signaling pathway; positive regulation of transcription, DNA-dependent; androgen receptor signaling pathway; spermatogenesis; negative regulation of transcription from RNA polymerase II promoter; JAK-STAT cascade; protein-DNA complex assembly; regulation of cell proliferation

Research Articles on PIAS1

Similar Products

Product Notes

The PIAS1 pias1 (Catalog #AAA3204506) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PIAS1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PIAS1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PIAS1 pias1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MADSAELKQM VMSLRVSELQ VLLGYAGRNK HGRKHELLTK ALHLLKAGCS. It is sometimes possible for the material contained within the vial of "PIAS1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.