Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.73kD).)

Mouse anti-Human PIAS1 Monoclonal Antibody | anti-PIAS1 antibody

PIAS1 (E3 SUMO-protein Ligase PIAS1, Protein Inhibitor of Activated STAT Protein 1, Gu Binding Protein, GBP, RNA Helicase II Binding Protein, DEAD/H Box-binding Protein 1, DDXBP1, MGC141878, MGC141879) (HRP)

Gene Names
PIAS1; GBP; ZMIZ3; DDXBP1; GU/RH-II
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PIAS1; Monoclonal Antibody; PIAS1 (E3 SUMO-protein Ligase PIAS1; Protein Inhibitor of Activated STAT Protein 1; Gu Binding Protein; GBP; RNA Helicase II Binding Protein; DEAD/H Box-binding Protein 1; DDXBP1; MGC141878; MGC141879) (HRP); anti-PIAS1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4A4
Specificity
Recognizes human PIAS1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-PIAS1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa543-651 from PIAS1 (NP_057250) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPYTSSQMFLDQLSAGGSTSLPTTNGSSSGSNSSLVSSNSLRESHSHTVTNRSSTDTASIFGIIPDIISLD*
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.73kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.73kD).)

Testing Data

(Detection limit for recombinant GST tagged PIAS1 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PIAS1 is ~0.03ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between TP53 and PIAS1 HeLa cells were stained with TP53 rabbit purified polyclonal 1:1200 and PIAS1 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between TP53 and PIAS1 HeLa cells were stained with TP53 rabbit purified polyclonal 1:1200 and PIAS1 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Related Product Information for anti-PIAS1 antibody
PIAS1 functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizing the interaction between UBE2I and the substrate, and as a SUMO-tethering factor. This protein plays a crucial role in transcriptional coregulation of various cellular pathways, including the STAT pathway, the p53 pathway and the steroid hormone signaling pathway. It functions in testis as a nuclear receptor transcriptional coregulator and may have a role in androgen receptor initiation and maintenance of spermatogenesis. The effects of transcriptional coregulation, transactivation or silencing, may vary depending upon the biological context.
Product Categories/Family for anti-PIAS1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36,204 Da
NCBI Official Full Name
E3 SUMO-protein ligase PIAS1
NCBI Official Synonym Full Names
protein inhibitor of activated STAT, 1
NCBI Official Symbol
PIAS1
NCBI Official Synonym Symbols
GBP; ZMIZ3; DDXBP1; GU/RH-II
NCBI Protein Information
E3 SUMO-protein ligase PIAS1; gu-binding protein; AR interacting protein; DEAD/H box-binding protein 1; RNA helicase II-binding protein; zinc finger, MIZ-type containing 3; protein inhibitor of activated STAT-1; protein inhibitor of activated STAT protein
UniProt Protein Name
E3 SUMO-protein ligase PIAS1
Protein Family
UniProt Gene Name
PIAS1
UniProt Synonym Gene Names
DDXBP1; GBP
UniProt Entry Name
PIAS1_HUMAN

NCBI Description

This gene encodes a member of the mammalian PIAS [protein inhibitor of activated STAT-1 (signal transducer and activator of transcription-1)] family. This member contains a putative zinc-binding motif and a highly acidic region. It inhibits STAT1-mediated gene activation and the DNA binding activity, binds to Gu protein/RNA helicase II/DEAD box polypeptide 21, and interacts with androgen receptor (AR). It functions in testis as a nuclear receptor transcriptional coregulator and may have a role in AR initiation and maintenance of spermatogenesis. [provided by RefSeq, Jul 2008]

Uniprot Description

PIAS1: Functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizing the interaction between UBE2I and the substrate, and as a SUMO-tethering factor. Plays a crucial role as a transcriptional coregulation in various cellular pathways, including the STAT pathway, the p53 pathway and the steroid hormone signaling pathway. In vitro, binds A/T-rich DNA. The effects of this transcriptional coregulation, transactivation or silencing, may vary depending upon the biological context. Together with PRMT1, may repress STAT1 transcriptional activity, in the late phase of interferon gamma (IFN-gamma) signaling. Interacts with NCOA2 and AR. Interacts with NR2C1; the interaction promotes its sumoylation. Interacts with DDX21, CSRP2, AXIN1, JUN, UBE2I, SUMO1, SATB2, PLAG1, TP53 and STAT1 (dimer), following IFNA1-stimulation. Interacts with SP3 (preferentially when SUMO-modified). Interacts with KLF8; the interaction results in SUMO ligation and repression of KLF8 transcriptional activity and of its cell cycle progression into G(1) phase. Interacts with STAT1. Interacts with CHUK/IKKA; this interaction induces PIAS1 phosphorylation. Interacts with PTK2/FAK1; the interaction promotes its sumoylation. Interacts with DDX5. Expressed in numerous tissues with highest level in testis. Belongs to the PIAS family.

Protein type: SUMO conjugating system; Transcription, coactivator/corepressor; Nuclear receptor co-regulator; EC 6.3.2.-

Chromosomal Location of Human Ortholog: 15q

Cellular Component: nucleoplasm; PML body; nuclear speck; nucleus

Molecular Function: protein domain specific binding; protein binding; enzyme binding; DNA binding; androgen receptor binding; zinc ion binding; ubiquitin protein ligase binding; transcription coactivator activity; transcription corepressor activity; ligase activity

Biological Process: positive regulation of protein sumoylation; protein sumoylation; transcription, DNA-dependent; positive regulation of smooth muscle cell differentiation; positive regulation of proteasomal ubiquitin-dependent protein catabolic process; cytokine and chemokine mediated signaling pathway; positive regulation of transcription, DNA-dependent; androgen receptor signaling pathway; spermatogenesis; negative regulation of transcription from RNA polymerase II promoter; JAK-STAT cascade; protein-DNA complex assembly; regulation of cell proliferation

Research Articles on PIAS1

Similar Products

Product Notes

The PIAS1 pias1 (Catalog #AAA6154148) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PIAS1 (E3 SUMO-protein Ligase PIAS1, Protein Inhibitor of Activated STAT Protein 1, Gu Binding Protein, GBP, RNA Helicase II Binding Protein, DEAD/H Box-binding Protein 1, DDXBP1, MGC141878, MGC141879) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PIAS1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PIAS1 pias1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PIAS1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.