Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using PHRF1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)
Rabbit anti-Human PHRF1 Polyclonal Antibody | anti-PHRF1 antibody
PHRF1 Rabbit pAb
Gene Names
PHRF1; RNF221; PPP1R125
Reactivity
Human
Applications
Western Blot
Purity
Affinity purification
Synonyms
PHRF1; Polyclonal Antibody; PHRF1 Rabbit pAb; PPP1R125; RNF221; anti-PHRF1 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
KAEAPSSPDVAPAGKEDSPSASGRVQEAARPEEVVSQTPLLRSRALVKRVTWNLQESESSAPAEDRAPRAPLHRPQKPREGAWDMEDVAPTGVRQVFSELP
Applicable Applications for anti-PHRF1 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1350-1450 of human PHRF1 (NP_001273512.1).
Positive Samples
Juakat, K-562, HepG2, HeLa
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using PHRF1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using PHRF1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
178,666 Da
NCBI Official Full Name
PHD and RING finger domain-containing protein 1 isoform 1
NCBI Official Synonym Full Names
PHD and ring finger domains 1
NCBI Official Symbol
PHRF1
NCBI Official Synonym Symbols
RNF221; PPP1R125
NCBI Protein Information
PHD and RING finger domain-containing protein 1; CTD-binding SR-like protein rA9; protein phosphatase 1, regulatory subunit 125
UniProt Protein Name
PHD and RING finger domain-containing protein 1
Protein Family
UniProt Gene Name
PHRF1
UniProt Synonym Gene Names
KIAA1542
UniProt Entry Name
PHRF1_HUMAN
Similar Products
Product Notes
The PHRF1 phrf1 (Catalog #AAA9142653) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PHRF1 Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PHRF1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the PHRF1 phrf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: KAEAPSSPDV APAGKEDSPS ASGRVQEAAR PEEVVSQTPL LRSRALVKRV TWNLQESESS APAEDRAPRA PLHRPQKPRE GAWDMEDVAP TGVRQVFSEL P. It is sometimes possible for the material contained within the vial of "PHRF1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
