Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-PHKG1 Polyclonal Antibody)

Rabbit anti-Mouse PHKG1 Polyclonal Antibody | anti-PHKG1 antibody

PHKG1 Polyclonal Antibody

Gene Names
PHKG1; PHKG
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity Purification
Synonyms
PHKG1; Polyclonal Antibody; PHKG1 Polyclonal Antibody; PHKG; phosphorylase kinase catalytic subunit gamma 1; anti-PHKG1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
1.2 mg/ml (varies by lot)
Sequence Length
419
Applicable Applications for anti-PHKG1 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 245-350 of human PHKG1 (NP_006204.1).
Immunogen Sequence
GNYQFGSPEWDDYSDTVKDLVSRFLVVQPQNRYTAEEALAHPFFQQYLVEEVRHFSPRGKFKVIALTVLASVRIYYQYRRVKPVTREIVIRDPYALRPLRRLIDAY
Positive Samples
Mouse Kidney
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-PHKG1 Polyclonal Antibody)

Western Blot (WB) (Western blot-PHKG1 Polyclonal Antibody)
Related Product Information for anti-PHKG1 antibody
This gene is a member of the Ser/Thr protein kinase family and encodes a protein with one protein kinase domain and two calmodulin-binding domains. This protein is the catalytic member of a 16 subunit protein kinase complex which contains equimolar ratios of 4 subunit types. The complex is a crucial glycogenolytic regulatory enzyme. This gene has two pseudogenes at chromosome 7q11.21 and one at chromosome 11p11.12. Multiple transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 45kDa; 48kDa
Observed: 55kDa
NCBI Official Full Name
phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform isoform 1
NCBI Official Synonym Full Names
phosphorylase kinase catalytic subunit gamma 1
NCBI Official Symbol
PHKG1
NCBI Official Synonym Symbols
PHKG
NCBI Protein Information
phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform
UniProt Protein Name
Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform
Protein Family
UniProt Gene Name
PHKG1
UniProt Synonym Gene Names
PHKG; PHK-gamma-M
UniProt Entry Name
PHKG1_HUMAN

NCBI Description

This gene is a member of the Ser/Thr protein kinase family and encodes a protein with one protein kinase domain and two calmodulin-binding domains. This protein is the catalytic member of a 16 subunit protein kinase complex which contains equimolar ratios of 4 subunit types. The complex is a crucial glycogenolytic regulatory enzyme. This gene has two pseudogenes at chromosome 7q11.21 and one at chromosome 11p11.12. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2012]

Uniprot Description

PHKG1: a Ca(2+)/calmodulin-dependent protein kinase of the PHK family. Phosphorylase kinase is a polymer of 16 chains, four each of alpha, beta, gamma, and delta. Alpha and beta are regulatory chains, gamma is the catalytic chain, and delta is calmodulin.

Protein type: Kinase, protein; Protein kinase, CAMK; EC 2.7.11.26; Protein kinase, Ser/Thr (non-receptor); EC 2.7.11.1; EC 2.7.11.19; CAMK group; PHK family

Chromosomal Location of Human Ortholog: 7p11.2

Cellular Component: phosphorylase kinase complex; cytosol

Molecular Function: calmodulin binding; phosphorylase kinase activity; enzyme binding; tau-protein kinase activity; ATP binding

Biological Process: glycogen biosynthetic process; glycogen catabolic process; carbohydrate metabolic process; glucose metabolic process; pathogenesis; protein amino acid phosphorylation

Similar Products

Product Notes

The PHKG1 phkg1 (Catalog #AAA9140435) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PHKG1 Polyclonal Antibody reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's PHKG1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the PHKG1 phkg1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PHKG1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.