Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (PHF11 rabbit polyclonal antibody. Western Blot analysis of PHF11 expression in mouse spleen.)

Rabbit anti-Human, Mouse PHF11 Polyclonal Antibody | anti-PHF11 antibody

PHF11 (PHD Finger Protein 11, BRCA1 C-terminus-associated Protein, Renal Carcinoma Antigen NY-REN-34, BCAP)

Gene Names
PHF11; APY; BCAP; IGEL; IGER; IGHER; NYREN34; NY-REN-34; RP11-185C18.3
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
PHF11; Polyclonal Antibody; PHF11 (PHD Finger Protein 11; BRCA1 C-terminus-associated Protein; Renal Carcinoma Antigen NY-REN-34; BCAP); Anti -PHF11 (PHD Finger Protein 11; anti-PHF11 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human PHF11. Species Crossreactivity: mouse.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MEKRTCALCPKDVEYNVLYFAQSENIAAHENCLLYSSGLVECEDQDPLNPDRSFDVESVKKEIQRGRKLKCKFCHKRGATVGCDLKNCNKNYHFFCAKKDDAVPQSDGVRGIYKLLCQQHAQFPIIAQSAKFSGVKRKRGRKKPLSGNHVQPPETMKCNTFIRQVKEEHGRHTDATVKVPFLKKCKEAGLLNYLLEEILDKVHSIPEKLMDETTSESDYEEIGSALFDCRLFEDTFVNFQAAIEKKIHASQQRWQQLKEEIELLQDLKQTLCSFQENRDLMSSSTSISSLSY
Applicable Applications for anti-PHF11 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human PHF11, aa1-292 (NP_001035534.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(PHF11 rabbit polyclonal antibody. Western Blot analysis of PHF11 expression in mouse spleen.)

Western Blot (WB) (PHF11 rabbit polyclonal antibody. Western Blot analysis of PHF11 expression in mouse spleen.)

Western Blot (WB)

(Western Blot analysis of PHF11 expression in transfected 293T cell line by PHF11 polyclonal antibody. Lane 1: PHF11 transfected lysate (33.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PHF11 expression in transfected 293T cell line by PHF11 polyclonal antibody. Lane 1: PHF11 transfected lysate (33.5kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-PHF11 antibody
Positive regulator of Th1-type cytokine gene expression.
Product Categories/Family for anti-PHF11 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37,582 Da
NCBI Official Full Name
PHD finger protein 11 isoform b
NCBI Official Synonym Full Names
PHD finger protein 11
NCBI Official Symbol
PHF11
NCBI Official Synonym Symbols
APY; BCAP; IGEL; IGER; IGHER; NYREN34; NY-REN-34; RP11-185C18.3
NCBI Protein Information
PHD finger protein 11; NY-REN-34 antigen; IgE responsiveness (atopic); renal carcinoma antigen NY-REN-34; BRCA1 C-terminus-associated protein
UniProt Protein Name
PHD finger protein 11
Protein Family
UniProt Gene Name
PHF11
UniProt Synonym Gene Names
BCAP
UniProt Entry Name
PHF11_HUMAN

Uniprot Description

PHF11: Positive regulator of Th1-type cytokine gene expression. 2 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 13q14.2

Cellular Component: nucleus

Molecular Function: zinc ion binding

Biological Process: transcription, DNA-dependent; regulation of transcription, DNA-dependent

Disease: Asthma, Susceptibility To; Ige Responsiveness, Atopic

Research Articles on PHF11

Similar Products

Product Notes

The PHF11 phf11 (Catalog #AAA6003350) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PHF11 (PHD Finger Protein 11, BRCA1 C-terminus-associated Protein, Renal Carcinoma Antigen NY-REN-34, BCAP) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's PHF11 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the PHF11 phf11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MEKRTCALCP KDVEYNVLYF AQSENIAAHE NCLLYSSGLV ECEDQDPLNP DRSFDVESVK KEIQRGRKLK CKFCHKRGAT VGCDLKNCNK NYHFFCAKKD DAVPQSDGVR GIYKLLCQQH AQFPIIAQSA KFSGVKRKRG RKKPLSGNHV QPPETMKCNT FIRQVKEEHG RHTDATVKVP FLKKCKEAGL LNYLLEEILD KVHSIPEKLM DETTSESDYE EIGSALFDCR LFEDTFVNFQ AAIEKKIHAS QQRWQQLKEE IELLQDLKQT LCSFQENRDL MSSSTSISSL SY. It is sometimes possible for the material contained within the vial of "PHF11, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.