Western Blot (WB)
(WB Suggested Anti-PHAR3 antibody Titration: 1 ug/mLSample Type: Human 786-0 Whole Cell)
Rabbit anti-Human PHACTR3 Polyclonal Antibody | anti-PHACTR3 antibody
PHACTR3 Antibody - middle region
Gene Names
PHACTR3; H17739; SCAPIN1; PPP1R123; SCAPININ; C20orf101
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
PHACTR3; Polyclonal Antibody; PHACTR3 Antibody - middle region; anti-PHACTR3 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SPHLTTVHRPLPPSRVIEELHRALATKHRQDSFQGRESKGSPKKRLDVRL
Sequence Length
559
Applicable Applications for anti-PHACTR3 antibody
Western Blot (WB)
Immunogen
The immunogen for Anti-PHACTR3 antibody is: synthetic peptide directed towards the middle region of Human PHAR3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-PHAR3 antibody Titration: 1 ug/mLSample Type: Human 786-0 Whole Cell)
Western Blot (WB)
(WB Suggested Anti-PHAR3 antibody Titration: 1 ug/mLSample Type: Human 786-0 Whole Cell)
Related Product Information for anti-PHACTR3 antibody
This is a rabbit polyclonal antibody against PHAR3. It was validated on Western Blot
Target Description: This gene encodes a member of the phosphatase and actin regulator protein family. The encoded protein is associated with the nuclear scaffold in proliferating cells, and binds to actin and the catalytic subunit of protein phosphatase-1, suggesting that it functions as a regulatory subunit of protein phosphatase-1. Alternative splicing results in multiple transcript variants.
Target Description: This gene encodes a member of the phosphatase and actin regulator protein family. The encoded protein is associated with the nuclear scaffold in proliferating cells, and binds to actin and the catalytic subunit of protein phosphatase-1, suggesting that it functions as a regulatory subunit of protein phosphatase-1. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-PHACTR3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61 kDa
NCBI Official Full Name
phosphatase and actin regulator 3 isoform 4
NCBI Official Synonym Full Names
phosphatase and actin regulator 3
NCBI Official Symbol
PHACTR3
NCBI Official Synonym Symbols
H17739; SCAPIN1; PPP1R123; SCAPININ; C20orf101
NCBI Protein Information
phosphatase and actin regulator 3
UniProt Protein Name
Phosphatase and actin regulator 3
Protein Family
UniProt Gene Name
PHACTR3
UniProt Synonym Gene Names
C20orf101; SCAPIN1; Scapinin
UniProt Entry Name
PHAR3_HUMAN
NCBI Description
This gene encodes a member of the phosphatase and actin regulator protein family. The encoded protein is associated with the nuclear scaffold in proliferating cells, and binds to actin and the catalytic subunit of protein phosphatase-1, suggesting that it functions as a regulatory subunit of protein phosphatase-1. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]
Research Articles on PHACTR3
Similar Products
Product Notes
The PHACTR3 phactr3 (Catalog #AAA3219318) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PHACTR3 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PHACTR3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PHACTR3 phactr3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SPHLTTVHRP LPPSRVIEEL HRALATKHRQ DSFQGRESKG SPKKRLDVRL. It is sometimes possible for the material contained within the vial of "PHACTR3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
