Western Blot (WB)
(WB Suggested Anti-PHACS Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysate)
Rabbit PHACS Polyclonal Antibody | anti-ACCS antibody
PHACS antibody - middle region
Gene Names
ACCS; ACS; PHACS
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
PHACS; Polyclonal Antibody; PHACS antibody - middle region; anti-ACCS antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RSVLSLERLPDPQRTHVMWATSKDFGMSGLRFGTLYTENQDVATAVASLC
Sequence Length
390
Applicable Applications for anti-ACCS antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PHACS
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-PHACS Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysate)
Western Blot (WB)
(WB Suggested Anti-PHACS Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-ACCS antibody
This is a rabbit polyclonal antibody against PHACS. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: PHACS does not catalyze the synthesis of 1-aminocyclopropane-1-carboxylate but is capable of catalyzing the deamination of L-vinylglycine.
Target Description: PHACS does not catalyze the synthesis of 1-aminocyclopropane-1-carboxylate but is capable of catalyzing the deamination of L-vinylglycine.
Product Categories/Family for anti-ACCS antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
1-aminocyclopropane-1-carboxylate synthase, isoform CRA_b
NCBI Official Synonym Full Names
1-aminocyclopropane-1-carboxylate synthase homolog (inactive)
NCBI Official Symbol
ACCS
NCBI Official Synonym Symbols
ACS; PHACS
NCBI Protein Information
1-aminocyclopropane-1-carboxylate synthase-like protein 1
UniProt Protein Name
1-aminocyclopropane-1-carboxylate synthase-like protein 1
UniProt Gene Name
ACCS
UniProt Synonym Gene Names
PHACS; ACC synthase-like protein 1
UniProt Entry Name
1A1L1_HUMAN
Uniprot Description
ACCS: Does not catalyze the synthesis of 1-aminocyclopropane- 1-carboxylate but is capable of catalyzing the deamination of L- vinylglycine. Belongs to the class-I pyridoxal-phosphate-dependent aminotransferase family.
Protein type: Lyase
Chromosomal Location of Human Ortholog: 11p11
Molecular Function: 1-aminocyclopropane-1-carboxylate synthase activity; protein homodimerization activity; pyridoxal phosphate binding
Biological Process: biosynthetic process
Research Articles on ACCS
Similar Products
Product Notes
The ACCS accs (Catalog #AAA3209265) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PHACS antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PHACS can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ACCS accs for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RSVLSLERLP DPQRTHVMWA TSKDFGMSGL RFGTLYTENQ DVATAVASLC. It is sometimes possible for the material contained within the vial of "PHACS, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
