Western Blot (WB)
(Host: RabbitTarget Name: PGLSSample Tissue: HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Human PGLS Polyclonal Antibody | anti-PGLS antibody
PGLS Antibody - middle region
Gene Names
PGLS; 6PGL; HEL-S-304
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
PGLS; Polyclonal Antibody; PGLS Antibody - middle region; anti-PGLS antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 16% sucrose.
Sequence
Synthetic peptide located within the following region: FPDHPLLQEREKIVAPISDSPKPPPQRVTLTLPVLNAARTVIFVATGEGK
Sequence Length
258
Applicable Applications for anti-PGLS antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PGLS
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: PGLSSample Tissue: HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: PGLSSample Tissue: HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Product Categories/Family for anti-PGLS antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28 kDa
NCBI Official Full Name
6-phosphogluconolactonase
NCBI Official Synonym Full Names
6-phosphogluconolactonase
NCBI Official Symbol
PGLS
NCBI Official Synonym Symbols
6PGL; HEL-S-304
NCBI Protein Information
6-phosphogluconolactonase
UniProt Protein Name
6-phosphogluconolactonase
UniProt Gene Name
PGLS
UniProt Synonym Gene Names
6PGL
UniProt Entry Name
6PGL_HUMAN
Uniprot Description
PGLS: Hydrolysis of 6-phosphogluconolactone to 6- phosphogluconate. Belongs to the glucosamine/galactosamine-6-phosphate isomerase family. 6-phosphogluconolactonase subfamily.
Protein type: Carbohydrate Metabolism - pentose phosphate pathway; Hydrolase; EC 3.1.1.31
Chromosomal Location of Human Ortholog: 19p13.2
Cellular Component: cytosol
Molecular Function: monosaccharide binding; 6-phosphogluconolactonase activity
Biological Process: pentose-phosphate shunt; carbohydrate metabolic process; pentose-phosphate shunt, oxidative branch; pathogenesis
Similar Products
Product Notes
The PGLS pgls (Catalog #AAA3219810) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PGLS Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PGLS can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PGLS pgls for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FPDHPLLQER EKIVAPISDS PKPPPQRVTL TLPVLNAART VIFVATGEGK. It is sometimes possible for the material contained within the vial of "PGLS, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
