Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PGD AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole CellPGD is supported by BioGPS gene expression data to be expressed in Jurkat)

Rabbit PGD Polyclonal Antibody | anti-PGD antibody

PGD Antibody - N-terminal region

Gene Names
PGD; 6PGD
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PGD; Polyclonal Antibody; PGD Antibody - N-terminal region; anti-PGD antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKGILFVGSGVSGGE
Sequence Length
483
Applicable Applications for anti-PGD antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%; Yeast: 85%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of PGD
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PGD AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole CellPGD is supported by BioGPS gene expression data to be expressed in Jurkat)

Western Blot (WB) (WB Suggested Anti-PGD AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole CellPGD is supported by BioGPS gene expression data to be expressed in Jurkat)
Related Product Information for anti-PGD antibody
This is a rabbit polyclonal antibody against PGD. It was validated on Western Blot

Target Description: 6-phosphogluconate dehydrogenase is the second dehydrogenase in the pentose phosphate shunt. Deficiency of this enzyme is generally asymptomatic, and the inheritance of this disorder is autosomal dominant. Hemolysis results from combined deficiency of 6-phosphogluconate dehydrogenase and 6-phosphogluconolactonase suggesting a synergism of the two enzymopathies.
Product Categories/Family for anti-PGD antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53kDa
NCBI Official Full Name
6-phosphogluconate dehydrogenase, decarboxylating isoform 1
NCBI Official Synonym Full Names
phosphogluconate dehydrogenase
NCBI Official Symbol
PGD
NCBI Official Synonym Symbols
6PGD
NCBI Protein Information
6-phosphogluconate dehydrogenase, decarboxylating
UniProt Protein Name
6-phosphogluconate dehydrogenase, decarboxylating
UniProt Gene Name
PGD
UniProt Synonym Gene Names
PGDH
UniProt Entry Name
6PGD_HUMAN

NCBI Description

6-phosphogluconate dehydrogenase is the second dehydrogenase in the pentose phosphate shunt. Deficiency of this enzyme is generally asymptomatic, and the inheritance of this disorder is autosomal dominant. Hemolysis results from combined deficiency of 6-phosphogluconate dehydrogenase and 6-phosphogluconolactonase suggesting a synergism of the two enzymopathies. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2015]

Uniprot Description

PGD: an oxidative carboxylase that catalyses the decarboxylating reduction of 6-phosphogluconate into ribulose 5-phosphate in the presence of NADP. This reaction is a component of the hexose mono-phosphate shunt and pentose phosphate pathways.

Protein type: Oxidoreductase; Carbohydrate Metabolism - pentose phosphate pathway; Other Amino Acids Metabolism - glutathione; EC 1.1.1.44

Chromosomal Location of Human Ortholog: 1p36.22

Cellular Component: nucleus; cytosol

Molecular Function: phosphogluconate dehydrogenase (decarboxylating) activity; NADP binding

Biological Process: pentose-phosphate shunt; pentose-phosphate shunt, oxidative branch; carbohydrate metabolic process; pathogenesis; D-gluconate metabolic process; pentose biosynthetic process

Research Articles on PGD

Similar Products

Product Notes

The PGD pgd (Catalog #AAA3215856) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PGD Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PGD can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PGD pgd for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DFIEKLVPLL DTGDIIIDGG NSEYRDTTRR CRDLKAKGIL FVGSGVSGGE. It is sometimes possible for the material contained within the vial of "PGD, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.