Rabbit PFN1 Polyclonal Antibody | anti-PFN1 antibody

PFN1 antibody - N-terminal region

Cat. Num. AAA3208948

• Gene Names: PFN1; ALS18
• Reactivity: Tested Species Reactivity: Human, Mouse; Predicted Species Reactivity: Cow, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
• Applications: Western Blot
• Purity: Affinity Purified
• Synonyms: PFN1; Polyclonal Antibody; PFN1 antibody - N-terminal region; anti-PFN1 antibody

• Host: Rabbit
• Reactivity: Tested Species Reactivity: Human, Mouse; Predicted Species Reactivity: Cow, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: AGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVL
• Sequence Length: 140

• Applicable Applications for anti-PFN1 antibody: Western Blot (WB)
• Homology: Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 91%
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PFN1
• Protein size (#AA): 140 amino acids
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-PFN1 antibodyFormalin Fixed Paraffin Embedded Tissue: Human LiverPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Immunohistochemistry (IHC)

(Rabbit Anti-PFN1 antibodyFormalin Fixed Paraffin Embedded Tissue: Human SpleenPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Immunohistochemistry (IHC)

(Rabbit Anti-PFN1 antibodyFormalin Fixed Paraffin Embedded Tissue: Human TonsilPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Western Blot (WB)

(Lanes:1. 20 ug human pregnant uterine muscle cells + hormone 2. 20 ug human pregnant uterine muscle cells - hormonePrimary Antibody Dilution:1:2000Secondary Antibody:Goat anti-rabbit-Alexa Fluor 680Secondary Antibody Dilution:1:25,000Gene Name:PFN1Submitted by:Anonymous)

Western Blot (WB)

(Lanes:1. 20 ug murine non-pregnant uteria tissue 2. 20 ug murine non-laboring uterine tissue 3. 20 ug murine laboring uterine tissue 4. 20 ug murine preterm laboring uterine tissuePrimary Antibody Dilution:1:2000Secondary Antibody:Goat anti-rabbit-Alexa Fluor 680Secondary Antibody Dilution:1:25,000Gene Name:PFN1Submitted by:Anonymous)

Western Blot (WB)

(WB Suggested Anti-PFN1 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Liver)

Western Blot (WB)

(25 ug of the indicated Human whole cell extracts was loaded onto a 10-20% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Canonical 15 kDa isoform is identified, and a second isoform of 18 kDa is also present in some samples.)

Related Product Information for anti-PFN1 antibody

Description: PFN1 is a ubiquitous actin monomer-binding protein belonging to the profilin family. It is thought to regulate actin polymerization in response to extracellular signals. Deletion of this gene is associated with Miller-Dieker syndrome.The protein encoded by this gene is a ubiquitous actin monomer-binding protein belonging to the profilin family. It is thought to regulate actin polymerization in response to extracellular signals. Deletion of this gene is associated with Miller-Dieker syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Product Categories/Family for anti-PFN1 antibody

Polyclonal; Transcription Regulation; Drugs and Drug Metabolism; E3 & Ubiquitin; DNA/RNA/Protein Interactions; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 4826898
• NCBI GeneID: 5216
• NCBI Accession #: NP_005013
• NCBI GenBank Nucleotide #: NM_005022
• UniProt Accession #: P07737
• Molecular Weight: 15kDa
• NCBI Official Full Name: profilin-1
• NCBI Official Synonym Full Names: profilin 1
• NCBI Official Symbol: PFN1
• NCBI Official Synonym Symbols: ALS18
• NCBI Protein Information: profilin-1
• UniProt Protein Name: Profilin-1
• UniProt Gene Name: PFN1
• UniProt Entry Name: PROF1_HUMAN

NCBI Description

This gene encodes a member of the profilin family of small actin-binding proteins. The encoded protein plays an important role in actin dynamics by regulating actin polymerization in response to extracellular signals. Deletion of this gene is associated with Miller-Dieker syndrome, and the encoded protein may also play a role in Huntington disease. Multiple pseudogenes of this gene are located on chromosome 1. [provided by RefSeq, Jul 2012]