Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of Periplakin expression in rat stomach extract (lane 1) and HELA whole cell lysates (lane 2). Periplakin at 202KD was detected using rabbit anti- Periplakin Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Rabbit Periplakin Polyclonal Antibody | anti-PPL antibody

Anti-Periplakin Antibody

Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Immunogen affinity purified.
Synonyms
Periplakin; Polyclonal Antibody; Anti-Periplakin Antibody; ppl; O60437; anti-PPL antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
1756
Applicable Applications for anti-PPL antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes
Western Blot: 0.1-0.5ug/ml
Immunohistochemistry(IHC) Paraffin: 0.5-1ug/ml
Notes
Tested Species: In-house tested species with positive results.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Periplakin (1664-1701aa DTGRELSPEEAHRAGLIDWNMFVKLRSQECDWEEISVK), different from the related mouse sequence by one amino acid.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of Periplakin expression in rat stomach extract (lane 1) and HELA whole cell lysates (lane 2). Periplakin at 202KD was detected using rabbit anti- Periplakin Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Western Blot (WB) (Western blot analysis of Periplakin expression in rat stomach extract (lane 1) and HELA whole cell lysates (lane 2). Periplakin at 202KD was detected using rabbit anti- Periplakin Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Immunohistochemistry (IHC)

(Periplakin was detected in paraffin-embedded sections of mouse lung tissues using rabbit anti- Periplakin Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Immunohistochemistry (IHC) (Periplakin was detected in paraffin-embedded sections of mouse lung tissues using rabbit anti- Periplakin Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Immunohistochemistry (IHC)

(Periplakin was detected in paraffin-embedded sections of rat lung tissues using rabbit anti- Periplakin Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Immunohistochemistry (IHC) (Periplakin was detected in paraffin-embedded sections of rat lung tissues using rabbit anti- Periplakin Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Immunohistochemistry (IHC)

(Periplakin was detected in paraffin-embedded sections of rat skin tissues using rabbit anti- Periplakin Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Immunohistochemistry (IHC) (Periplakin was detected in paraffin-embedded sections of rat skin tissues using rabbit anti- Periplakin Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Immunohistochemistry (IHC)

(Periplakin was detected in paraffin-embedded sections of human tonsil tissues using rabbit anti- Periplakin Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Immunohistochemistry (IHC) (Periplakin was detected in paraffin-embedded sections of human tonsil tissues using rabbit anti- Periplakin Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Immunohistochemistry (IHC)

(Periplakin was detected in paraffin-embedded sections of human lung cancer tissues using rabbit anti- Periplakin Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Immunohistochemistry (IHC) (Periplakin was detected in paraffin-embedded sections of human lung cancer tissues using rabbit anti- Periplakin Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Immunohistochemistry (IHC)

(Periplakin was detected in paraffin-embedded sections of human oesophagus squama cancer tissues using rabbit anti- Periplakin Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Immunohistochemistry (IHC) (Periplakin was detected in paraffin-embedded sections of human oesophagus squama cancer tissues using rabbit anti- Periplakin Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )
Related Product Information for anti-PPL antibody
Rabbit IgG polyclonal antibody for Periplakin(PPL) detection.
Background: Periplakin is a protein that in humans is encoded by the PPL gene. The protein encoded by this gene is a component of desmosomes and of the epidermal cornified envelope in keratinocytes. The N-terminal domain of this protein interacts with the plasma membrane and its C-terminus interacts with intermediate filaments. Through its rod domain, this protein forms complexes with envoplakin. This protein may serve as a link between the cornified envelope and desmosomes as well as intermediate filaments. AKT1/PKB, a protein kinase mediating a variety of cell growth and survival signaling processes, is reported to interact with this protein, suggesting a possible role for this protein as a localization signal in AKT1-mediated signaling.
References
1. "Entrez Gene: PPL periplakin".
2. Aho S, McLean WH, Li K, Uitto J (Jun 1998). "cDNA cloning, mRNA expression, and chromosomal mapping of human and mouse periplakin genes". Genomics. 48 (2): 242-7.
3. Kazerounian, Shideh; Uitto Jouni; Aho Sirpa (Oct 2002). "Unique role for the periplakin tail in intermediate filament association: specific binding to keratin 8 and vimentin". Exp. Dermatol. Denmark. 11(5): 428-38.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
204,747 Da
NCBI Official Full Name
periplakin
NCBI Official Synonym Full Names
periplakin
NCBI Official Symbol
PPL
NCBI Protein Information
periplakin
UniProt Protein Name
Periplakin
Protein Family
UniProt Gene Name
PPL
UniProt Synonym Gene Names
KIAA0568

NCBI Description

The protein encoded by this gene is a component of desmosomes and of the epidermal cornified envelope in keratinocytes. The N-terminal domain of this protein interacts with the plasma membrane and its C-terminus interacts with intermediate filaments. Through its rod domain, this protein forms complexes with envoplakin. This protein may serve as a link between the cornified envelope and desmosomes as well as intermediate filaments. AKT1/PKB, a protein kinase mediating a variety of cell growth and survival signaling processes, is reported to interact with this protein, suggesting a possible role for this protein as a localization signal in AKT1-mediated signaling. [provided by RefSeq, Jul 2008]

Uniprot Description

periplakin: Component of the cornified envelope of keratinocytes. May link the cornified envelope to desmosomes and intermediate filaments. May act as a localization signal in PKB/AKT-mediated signaling. Belongs to the plakin or cytolinker family.

Protein type: Cytoskeletal; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 16p13.3

Cellular Component: cell-cell adherens junction

Molecular Function: protein binding; structural constituent of cytoskeleton

Research Articles on PPL

Similar Products

Product Notes

The PPL ppl (Catalog #AAA178660) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-Periplakin Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Periplakin can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC) Paraffin. Western Blot: 0.1-0.5ug/ml Immunohistochemistry(IHC) Paraffin: 0.5-1ug/ml. Researchers should empirically determine the suitability of the PPL ppl for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Periplakin, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.