Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PECAM1Sample Tissue: Mouse Brain lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Mouse PECAM1 Polyclonal Antibody | anti-PECAM1 antibody

PECAM1 Antibody - middle region

Gene Names
Pecam1; CD31; Pecam
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
PECAM1; Polyclonal Antibody; PECAM1 Antibody - middle region; anti-PECAM1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IIEGNQLHIKCSVQVAHLAQEFPEIIIQKDKAIVATSKQSKEAVYSVMAL
Sequence Length
626
Applicable Applications for anti-PECAM1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse PECAM1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PECAM1Sample Tissue: Mouse Brain lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PECAM1Sample Tissue: Mouse Brain lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-PECAM1 antibody
cell adhesion molecule, also intracellular signaling molecule; may mediate leukocyte adhesion and migration, angiogenesis, and thrombosis.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
68 kDa
NCBI Official Full Name
platelet endothelial cell adhesion molecule
NCBI Official Synonym Full Names
platelet and endothelial cell adhesion molecule 1
NCBI Official Symbol
Pecam1
NCBI Official Synonym Symbols
CD31; Pecam
NCBI Protein Information
platelet endothelial cell adhesion molecule
UniProt Protein Name
Platelet endothelial cell adhesion molecule
UniProt Gene Name
Pecam1
UniProt Synonym Gene Names
Pecam; Pecam-1; PECAM-1
UniProt Entry Name
PECA1_MOUSE

NCBI Description

cell adhesion molecule, also intracellular signaling molecule; may mediate leukocyte adhesion and migration, angiogenesis, and thrombosis [RGD, Feb 2006]

Uniprot Description

PECAM-1: a cell adhesion molecule expressed on platelets and at endothelial cell intercellular junctions. Plays a role in modulation of integrin-mediated cell adhesion, transendothelial migration, angiogenesis, apoptosis, cell migration, negative regulation of immune cell signaling, autoimmunity, macrophage phagocytosis, IgE-mediated anaphylaxis and thrombosis. Undergoes alternative splicing, generating multiple isoforms in vascular beds of various tissues.

Protein type: Cell adhesion; Membrane protein, integral

Cellular Component: extracellular space; cell surface; smooth muscle contractile fiber; membrane; integral to membrane; plasma membrane; intracellular; cell junction; lipid raft; external side of plasma membrane

Molecular Function: protein binding

Biological Process: negative regulation of peptidyl-tyrosine phosphorylation; wound healing; positive regulation of tyrosine phosphorylation of Stat5 protein; negative regulation of actin filament polymerization; positive regulation of leukocyte migration; diapedesis; cell adhesion; regulation of cell migration; phagocytosis; Rho protein signal transduction

Research Articles on PECAM1

Similar Products

Product Notes

The PECAM1 pecam1 (Catalog #AAA3223629) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PECAM1 Antibody - middle region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's PECAM1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PECAM1 pecam1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IIEGNQLHIK CSVQVAHLAQ EFPEIIIQKD KAIVATSKQS KEAVYSVMAL. It is sometimes possible for the material contained within the vial of "PECAM1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.