Western Blot (WB)
(Host: RabbitTarget Name: PDZRN3Sample Type: Uterus Tumor lysatesAntibody Dilution: 1.0ug/ml)
Rabbit PDZRN3 Polyclonal Antibody | anti-PDZRN3 antibody
PDZRN3 Antibody - middle region
Gene Names
PDZRN3; LNX3; SEMCAP3; SEMACAP3
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PDZRN3; Polyclonal Antibody; PDZRN3 Antibody - middle region; anti-PDZRN3 antibody
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DPYLLPEEHPSAHEYYDPNDYIGDIHQEMDREELELEEVDLYRMNSQDKL
Sequence Length
729
Applicable Applications for anti-PDZRN3 antibody
Western Blot (WB)
Homology
Cow: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 79%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human PDZRN3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: PDZRN3Sample Type: Uterus Tumor lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: PDZRN3Sample Type: Uterus Tumor lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-PDZRN3 antibody
This is a rabbit polyclonal antibody against PDZRN3. It was validated on Western Blot
Target Description: PDZRN3 is an E3 ubiquitin-protein ligase. It plays an important role in regulating the surface level of MUSK on myotubes. It mediates the ubiquitination of MUSK, promoting its endocytosis and lysosomal degradation. It might contribute to terminal myogenic differentiation.
Target Description: PDZRN3 is an E3 ubiquitin-protein ligase. It plays an important role in regulating the surface level of MUSK on myotubes. It mediates the ubiquitination of MUSK, promoting its endocytosis and lysosomal degradation. It might contribute to terminal myogenic differentiation.
Product Categories/Family for anti-PDZRN3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
80kDa
NCBI Official Full Name
PDZ domain containing ring finger 3
NCBI Official Synonym Full Names
PDZ domain containing ring finger 3
NCBI Official Symbol
PDZRN3
NCBI Official Synonym Symbols
LNX3; SEMCAP3; SEMACAP3
NCBI Protein Information
E3 ubiquitin-protein ligase PDZRN3
UniProt Protein Name
E3 ubiquitin-protein ligase PDZRN3
Protein Family
UniProt Gene Name
PDZRN3
UniProt Synonym Gene Names
KIAA1095; LNX3; SEMCAP3
UniProt Entry Name
PZRN3_HUMAN
NCBI Description
This gene encodes a member of the LNX (Ligand of Numb Protein-X) family of RING-type ubiquitin E3 ligases. This protein may function in vascular morphogenesis and the differentiation of adipocytes, osteoblasts and myoblasts. This protein may be targeted for degradation by the human papilloma virus E6 protein. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2014]
Research Articles on PDZRN3
Similar Products
Product Notes
The PDZRN3 pdzrn3 (Catalog #AAA3206752) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PDZRN3 Antibody - middle region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PDZRN3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PDZRN3 pdzrn3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DPYLLPEEHP SAHEYYDPND YIGDIHQEMD REELELEEVD LYRMNSQDKL. It is sometimes possible for the material contained within the vial of "PDZRN3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
