Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of PDRG1 expression in transfected 293T cell line by PDRG1 MaxPab polyclonal antibody.Lane 1: PDRG1 transfected lysate(15.5 KDa).Lane 2: Non-transfected lysate.)

Rabbit anti-Human PDRG1 Polyclonal Antibody | anti-PDRG1 antibody

PDRG1 (p53 and DNA Damage Regulated 1, C20orf126, PDRG) (AP)

Gene Names
PDRG1; PDRG; C20orf126
Reactivity
Human
Applications
Western Blot
Purity
Purified
Synonyms
PDRG1; Polyclonal Antibody; PDRG1 (p53 and DNA Damage Regulated 1; C20orf126; PDRG) (AP); p53 and DNA Damage Regulated 1; PDRG; anti-PDRG1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human PDRG1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-PDRG1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
PDRG1 (NP_110442.1, 1aa-133aa) full-length human protein.
Immunogen Sequence
MLSPEAERVLRYLVEVEELAEEVLADKRQIVDLDTKRNQNREGLRALQKDLSLSEDVMVCFGNMFIKMPHPETKEMIEKDQDHLDKEIEKLRKQLKVKVNRLFEAQGKPELKGFNLNPLNQDELKALKVILKG
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of PDRG1 expression in transfected 293T cell line by PDRG1 MaxPab polyclonal antibody.Lane 1: PDRG1 transfected lysate(15.5 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PDRG1 expression in transfected 293T cell line by PDRG1 MaxPab polyclonal antibody.Lane 1: PDRG1 transfected lysate(15.5 KDa).Lane 2: Non-transfected lysate.)
Related Product Information for anti-PDRG1 antibody
Rabbit polyclonal antibody raised against a full-length human PDRG1 protein.
Product Categories/Family for anti-PDRG1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15,511 Da
NCBI Official Full Name
p53 and DNA damage-regulated protein 1
NCBI Official Synonym Full Names
p53 and DNA-damage regulated 1
NCBI Official Symbol
PDRG1
NCBI Official Synonym Symbols
PDRG; C20orf126
NCBI Protein Information
p53 and DNA damage-regulated protein 1; p53 and DNA damage regulated 1
UniProt Protein Name
p53 and DNA damage-regulated protein 1
UniProt Gene Name
PDRG1
UniProt Synonym Gene Names
C20orf126; PDRG
UniProt Entry Name
PDRG1_HUMAN

Uniprot Description

PDRG1: May play a role in chaperone-mediated protein folding (Potential). Belongs to the prefoldin subunit beta family.

Chromosomal Location of Human Ortholog: 20q11.21

Cellular Component: cytoplasm; prefoldin complex

Molecular Function: unfolded protein binding

Biological Process: protein folding

Research Articles on PDRG1

Similar Products

Product Notes

The PDRG1 pdrg1 (Catalog #AAA6451344) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PDRG1 (p53 and DNA Damage Regulated 1, C20orf126, PDRG) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PDRG1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PDRG1 pdrg1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PDRG1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.