Rabbit DLST Polyclonal Antibody | anti-DLST antibody

DLST antibody - C-terminal region

Cat. Num. AAA3215245

• Gene Names: DLST; DLTS
• Reactivity: Tested Species Reactivity: Human; Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
• Applications: Western Blot, Immunohistochemistry
• Purity: Affinity Purified
• Synonyms: DLST; Polyclonal Antibody; DLST antibody - C-terminal region; anti-DLST antibody

• Host: Rabbit
• Reactivity: Tested Species Reactivity: Human; Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: FADIERTITELGEKARKNELAIEDMDGGTFTISNGGVFGSLFGTPIINPP
• Sequence Length: 453

• Applicable Applications for anti-DLST antibody: Western Blot (WB), Immunohistochemistry (IHC)
• Homology: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-DLST Antibody(MBS3215245) Formalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC)

(Rabbit Anti-DLST antibody(MBS3215245) Formalin Fixed Paraffin Embedded Tissue: Human HeartPrimary antibody Concentration: 1:200Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Immunohistochemistry (IHC)

(Rabbit Anti-DLST antibody(MBS3215245) Formalin Fixed Paraffin Embedded Tissue: Human KidneyPrimary antibody Concentration: 1:200Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Western Blot (WB)

(WB Suggested Anti-DLST AntibodyTitration: 1.0 ug/mlPositive Control: Placenta)

Related Product Information for anti-DLST antibody

This is a rabbit polyclonal antibody against DLST. It was validated on Western Blot

Target Description: The 2-oxoglutarate dehydrogenase complex catalyzes the overall conversion of 2-oxoglutarate to succinyl-CoA and CO2. It contains multiple copies of 3 enzymatic components: 2-oxoglutarate dehydrogenase (E1), dihydrolipoamide succinyltransferase (E2) and lipoamide dehydrogenase (E3).

Product Categories/Family for anti-DLST antibody

Polyclonal; Neurobiology; Transcription Regulation; Protein Kinases; Drugs and Drug Metabolism; Immunology; DNA/RNA/Protein Interactions

NCBI and Uniprot Product Information

• NCBI GI #: 19923748
• NCBI GeneID: 1743
• NCBI Accession #: NP_001924
• NCBI GenBank Nucleotide #: NM_001933
• UniProt Accession #: P36957
• Molecular Weight: 50kDa
• NCBI Official Full Name: dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial isoform 1
• NCBI Official Synonym Full Names: dihydrolipoamide S-succinyltransferase
• NCBI Official Symbol: DLST
• NCBI Official Synonym Symbols: DLTS
• NCBI Protein Information: dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial
• UniProt Protein Name: Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial
• Protein Family: Serine transporter
• UniProt Gene Name: DLST
• UniProt Synonym Gene Names: DLTS; OGDC-E2
• UniProt Entry Name: ODO2_HUMAN

NCBI Description

This gene encodes a mitochondrial protein that belongs to the 2-oxoacid dehydrogenase family. This protein is one of the three components (the E2 component) of the 2-oxoglutarate dehydrogenase complex that catalyzes the overall conversion of 2-oxoglutarate to succinyl-CoA and CO(2). Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Oct 2011]

Uniprot Description

DLST: The 2-oxoglutarate dehydrogenase complex catalyzes the overall conversion of 2-oxoglutarate to succinyl-CoA and CO(2). It contains multiple copies of 3 enzymatic components: 2-oxoglutarate dehydrogenase (E1), dihydrolipoamide succinyltransferase (E2) and lipoamide dehydrogenase (E3). Forms a 24-polypeptide structural core with octahedral symmetry. Belongs to the 2-oxoacid dehydrogenase family.

Protein type: Mitochondrial; Transferase; EC 2.3.1.61; Carbohydrate Metabolism - citrate (TCA) cycle; Amino Acid Metabolism - lysine degradation

Chromosomal Location of Human Ortholog: 14q24.3

Cellular Component: membrane; mitochondrial matrix; oxoglutarate dehydrogenase complex; nucleus

Molecular Function: dihydrolipoyllysine-residue succinyltransferase activity

Biological Process: cellular metabolic process; generation of precursor metabolites and energy; tricarboxylic acid cycle; L-lysine catabolic process to acetyl-CoA via saccharopine; lysine catabolic process