Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: MouseTarget Name: PDGFRBSample Tissue: Mouse Skeletal MuscleAntibody Dilution: 1ug/ml)

Rabbit anti-Human PDGFRB Polyclonal Antibody | anti-PDGFRB antibody

PDGFRB Antibody - middle region

Gene Names
PDGFRB; IMF1; KOGS; IBGC4; JTK12; PDGFR; PENTT; CD140B; PDGFR1; PDGFR-1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
PDGFRB; Polyclonal Antibody; PDGFRB Antibody - middle region; anti-PDGFRB antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RPPSAELYSNALPVGLPLPSHVSLTGESDGGYMDMSKDESVDYVPMLDMK
Sequence Length
1106
Applicable Applications for anti-PDGFRB antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PDGFRB
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: MouseTarget Name: PDGFRBSample Tissue: Mouse Skeletal MuscleAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: MouseTarget Name: PDGFRBSample Tissue: Mouse Skeletal MuscleAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: PDGFRBSample Tissue: Human Liver Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PDGFRBSample Tissue: Human Liver Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-PDGFRB antibody
This gene encodes a cell surface tyrosine kinase receptor for members of the platelet-derived growth factor family. These growth factors are mitogens for cells of mesenchymal origin. The identity of the growth factor bound to a receptor monomer determines whether the functional receptor is a homodimer or a heterodimer, composed of both platelet-derived growth factor receptor alpha and beta polypeptides. This gene is flanked on chromosome 5 by the genes for granulocyte-macrophage colony-stimulating factor and macrophage-colony stimulating factor receptor; all three genes may be implicated in the 5-q syndrome. A translocation between chromosomes 5 and 12, that fuses this gene to that of the translocation, ETV6, leukemia gene, results in chronic myeloproliferative disorder with eosinophilia.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
121 kDa
NCBI Official Full Name
platelet-derived growth factor receptor beta isoform 1
NCBI Official Synonym Full Names
platelet derived growth factor receptor beta
NCBI Official Symbol
PDGFRB
NCBI Official Synonym Symbols
IMF1; KOGS; IBGC4; JTK12; PDGFR; PENTT; CD140B; PDGFR1; PDGFR-1
NCBI Protein Information
platelet-derived growth factor receptor beta
UniProt Protein Name
Platelet-derived growth factor receptor beta
UniProt Gene Name
PDGFRB
UniProt Synonym Gene Names
PDGFR; PDGFR1; PDGF-R-beta; PDGFR-beta; PDGFR-1
UniProt Entry Name
PGFRB_HUMAN

NCBI Description

The protein encoded by this gene is a cell surface tyrosine kinase receptor for members of the platelet-derived growth factor family. These growth factors are mitogens for cells of mesenchymal origin. The identity of the growth factor bound to a receptor monomer determines whether the functional receptor is a homodimer (PDGFB or PDGFD) or a heterodimer (PDGFA and PDGFB). This gene is essential for normal development of the cardiovascular system and aids in rearrangement of the actin cytoskeleton. This gene is flanked on chromosome 5 by the genes for granulocyte-macrophage colony-stimulating factor and macrophage-colony stimulating factor receptor; all three genes may be implicated in the 5-q syndrome. A translocation between chromosomes 5 and 12, that fuses this gene to that of the ETV6 gene, results in chronic myeloproliferative disorder with eosinophilia. [provided by RefSeq, Aug 2017]

Uniprot Description

PDGFRB: a receptor tyrosine kinase of the PDGFR family that binds members of the platelet-derived growth factor family. The identity of the growth factor bound determines whether the functional receptor is a homodimer or a heterodimer, composed of both PDGFR-alpha and -beta. Ligand binding induces receptor dimerization and autophosphorylation, thereby recruiting SH2-containing proteins including Grb2, Src, GAP, PTPN11, PI3 kinase, PLC-gamma and Nck. Regulates cell growth, actin reorganization, migration and differentiation. A variety of myeloproliferative disorders and cancers result from translocations that activate PDGFRbeta by fusion with proteins such as TEL/ETV6, H2, CEV14/TRP11, rabaptin 5, and huntington interacting protein 1. Gleevec treatment of TEL fusions has been successful. Overexpressed in metastatic medulloblastoma. Inhibitors: Gleevec, Sutent.

Protein type: Kinase, protein; Protein kinase, TK; EC 2.7.10.1; Protein kinase, tyrosine (receptor); Membrane protein, integral; Oncoprotein; TK group; PDGFR family

Chromosomal Location of Human Ortholog: 5q33.1

Cellular Component: lysosomal lumen; focal adhesion; cell surface; membrane; apical plasma membrane; cytoplasm; cytoplasmic membrane-bound vesicle; integral to membrane; plasma membrane; nucleus; intrinsic to plasma membrane

Molecular Function: protein binding; platelet activating factor receptor activity; protein-tyrosine kinase activity; platelet-derived growth factor binding; platelet-derived growth factor beta-receptor activity; platelet-derived growth factor receptor binding; phosphoinositide 3-kinase binding; platelet-derived growth factor receptor activity; protein kinase binding; ATP binding; receptor binding

Biological Process: positive regulation of phosphoprotein phosphatase activity; peptidyl-tyrosine phosphorylation; wound healing; nerve growth factor receptor signaling pathway; response to toxin; protein amino acid autophosphorylation; positive regulation of smooth muscle cell proliferation; positive regulation of collagen biosynthetic process; platelet-derived growth factor receptor signaling pathway; cardiac myofibril assembly; signal transduction; positive regulation of smooth muscle cell migration; response to estradiol stimulus; smooth muscle development; positive regulation of MAP kinase activity; positive regulation of cell proliferation; tissue homeostasis; phosphatidylinositol metabolic process; regulation of peptidyl-tyrosine phosphorylation; inner ear development; epidermal growth factor receptor signaling pathway; cell migration; fibroblast growth factor receptor signaling pathway; response to retinoic acid; phosphoinositide-mediated signaling; positive regulation of mitosis; in utero embryonic development; positive regulation of chemotaxis; adrenal gland development; positive regulation of phosphoinositide 3-kinase activity; positive regulation of phosphoinositide 3-kinase cascade; glycosaminoglycan biosynthetic process; G-protein coupled receptor protein signaling pathway; response to hyperoxia; response to hydrogen peroxide; skeletal morphogenesis; regulation of actin cytoskeleton organization and biogenesis; innate immune response; negative regulation of apoptosis; positive regulation of cell migration

Disease: Myeloproliferative Disorder, Chronic, With Eosinophilia; Myofibromatosis, Infantile, 1; Basal Ganglia Calcification, Idiopathic, 1; Basal Ganglia Calcification, Idiopathic, 4

Research Articles on PDGFRB

Similar Products

Product Notes

The PDGFRB pdgfrb (Catalog #AAA3221106) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PDGFRB Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PDGFRB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PDGFRB pdgfrb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RPPSAELYSN ALPVGLPLPS HVSLTGESDG GYMDMSKDES VDYVPMLDMK. It is sometimes possible for the material contained within the vial of "PDGFRB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.