Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PDGFDSample Tissue: Mouse Testis lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Mouse PDGFD Polyclonal Antibody | anti-PDGFD antibody

PDGFD Antibody-N-terminal region

Reactivity
Mouse
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PDGFD; Polyclonal Antibody; PDGFD Antibody-N-terminal region; platelet-derived growth factor D; 1110003I09Rik; anti-PDGFD antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100ul at 0.5-1mg/ml (varies by lot)
Sequence
ALRNANLRRDESNHLTDLYQREENIQVTSNGHVQSPRFPNSYPRNLLLTW
Applicable Applications for anti-PDGFD antibody
Western Blot (WB)
Protein Size
370 amino acids
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of mouse PDGFD
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PDGFDSample Tissue: Mouse Testis lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PDGFDSample Tissue: Mouse Testis lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-PDGFD antibody
Description of Target: Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin. Plays an important role in wound healing (By similarity). Has oncogenic potential and can induce tumor formation. Induces macrophage recruitment, increased interstitial pressure, and blood vessel maturation during angiogenesis. Can initiate events that lead to a mesangial proliferative glomerulonephritis, including influx of monocytes and macrophages and production of extracellular matrix.

NCBI and Uniprot Product Information

NCBI GeneID
UniProt Accession #
Molecular Weight
40kDa
UniProt Protein Name
Platelet-derived growth factor D
UniProt Gene Name
Pdgfd
UniProt Synonym Gene Names
Scdgfb; PDGF-D; SCDGF-B; PDGFD latent form; PDGFD receptor-binding form
UniProt Entry Name
PDGFD_MOUSE

Uniprot Description

PDGFD: Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin. Plays an important role in wound healing. Induces macrophage recruitment, increased interstitial pressure, and blood vessel maturation during angiogenesis. Can initiate events that lead to a mesangial proliferative glomerulonephritis, including influx of monocytes and macrophages and production of extracellular matrix. Belongs to the PDGF/VEGF growth factor family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted, signal peptide; Secreted; Oncoprotein

Cellular Component: extracellular space; membrane; extracellular region

Molecular Function: growth factor activity; platelet-derived growth factor receptor binding

Biological Process: multicellular organismal development; positive regulation of cell division; platelet-derived growth factor receptor signaling pathway; cellular process; regulation of peptidyl-tyrosine phosphorylation

Similar Products

Product Notes

The PDGFD pdgfd (Catalog #AAA3249798) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PDGFD Antibody-N-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's PDGFD can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PDGFD pdgfd for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ALRNANLRRD ESNHLTDLYQ REENIQVTSN GHVQSPRFPN SYPRNLLLTW. It is sometimes possible for the material contained within the vial of "PDGFD, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.